SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000697 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000697
Domain Number 1 Region: 480-734
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-50
Family YWTD domain 0.0000083
Further Details:      
 
Domain Number 2 Region: 43-302
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-34
Family YWTD domain 0.0000404
Further Details:      
 
Domain Number 3 Region: 398-473,730-779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 973-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000518
Family EGF-type module 0.00047
Further Details:      
 
Domain Number 5 Region: 351-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000153
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 834-945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000091
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000697
Domain Number - Region: 331-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0479
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000697   Gene: ENSCPOG00000000779   Transcript: ENSCPOT00000000784
Sequence length 1189
Comment pep:known scaffold:cavPor3:scaffold_43:9134394:9209518:1 gene:ENSCPOG00000000779 transcript:ENSCPOT00000000784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETMLLLLSLVLLKISFVSVSAQPRWTCPEGPNGTSTCVGPAPFLIFTHENSIFRIDPEG
TNHEQLVVDAGASVIMDFHYKEGRIYWVDLETKLLQRVFLNGSRQEKVCNIEENVSGMAI
NWINEEVIWSNQQEGIITVTDLKGSNSHVLLSTLKQPTYIAVDPVERFIFWSSEEAGSLS
RADLGGVEVKSLLVTEKKITAMSLDVLNKRLFWVQEGGEGSDSHIGSCDYDGNSIQLIKH
PTQYSVFVMSVFGDRIFYSTWKKSSIWIASRLTGKDMVSINLKPSLTPPGQLKVVHPLVQ
PTGGDNVQDSEPGRHKLDKTLCDRGEDGRDPGSQSCACAEGYAPSQDRKSCEDVNECAFW
NHGCTLGCENIPGSYYCTCPAGFILLPDGKRCHELVSCPSGASGCSHGCVLTSDGPLCFC
PKGSVLQADGKTCSGCSSPDNGGCSQHCITRSPVSWECGCFPGYDLQLDGKSCAASGPQP
LLLFANSQDIRHMHFDGTDYRVLLSQQMGTVFALDHDPVENKMYFAHTALKWIERANMDG
SQRERLIEEDVDIPEGLAVDWIGRRLYWTDSGKSVIEGSDLNGKHRQIIIKENISRPRGI
AVHPMAKRLFWTDVGMNPRIESASLQGSGRLLIAGSDLTEPSGLTIDYLTDTLYWCDAMR
SVIEMANLDGSRRQRLGQGDVGRPFSVAVFEDHLWLSDWAAPSVIRVNKRTGQNRVRLRG
SVLRPASLVVVHPLAKPGTDPCLHQNGGCEHVCQERLGTAQCSCHEGFRSSADGKGCLAP
TSQQLSNGKTASGEADQSNQVTALDILPGMTAPEDSATGSQRMLVAEIVVSDEDECTPAA
CGEHAQCVSEGDRAMCQCAEGFAGDGKQCTDIDECAADRAVCPSPSSKCINTEGGYVCSC
AAGYRGDGLRCLDVDECQLEVHSCGPGANCINTEGGYTCLCAGSPWEPKLRCLDSTSSIS
LGEDGSGLVRNAQPGCPPSHDGYCLHGGVCMHIESLNTYACNCVIGYVGERCEHQDLKWE
LRHAGHRQQQDVAVAATGVVALVLLLLLGMWGAHRYRKKKLALKTPENPYEESHRDASGG
RPADSEGSLSSCPQPWFVVLKEDQNFRNMSQPVSGHNGQMADVGQFSSLEPGSGQPAWRT
QELCACGVGTEQGRWLPLSKDKEPGPQVTAQSFHLPSYVAKPLAMGVQE
Download sequence
Identical sequences 10141.ENSCPOP00000000697 ENSCPOP00000000697 ENSCPOP00000000697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]