SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000823 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000823
Domain Number 1 Region: 472-801
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.85e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000221
Further Details:      
 
Domain Number 2 Region: 807-934
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.84e-18
Family Ricin B-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000823   Gene: ENSCPOG00000000913   Transcript: ENSCPOT00000000919
Sequence length 939
Comment pep:known scaffold:cavPor3:scaffold_3:31165181:31209700:-1 gene:ENSCPOG00000000913 transcript:ENSCPOT00000000919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIRKFFRGSGRVLAFIFAASVIWLLFDMAALRLSFSEINTRLLREDIVRREQIGFRVQ
ADQEKILSSSIRKMRPSPGGLGKRVWGKENFRKIEDSVLEMGDDLDQAQKERKMQNTLMK
GKVLPLWHPGHRQTPTGTLTKQKAEVKGSKSKAFSFQMTPRQTTVQGAQKSPFIAARRAA
LVNTSGYTETVSTKQEILKTHSLSSDTSKQVAEGDITVTIDLRTNKTKQQSQAVANKRTH
PANPPVPNSVEATASNKTETQNKELHAKKHKVHKGLPFFKLITDSKGLRKLSMNKTQLRG
LPEDVGTLKEQLNFSESHVVIITKEEELKTDTKKTSNSKIKTILPEIVDKSQGKQISRIR
SKASFPSPVLQKAIVSRTRNEIDEGLRPAGINLTAKAQPAEHKQSHAKVLVPEDHGMHQV
LKIDVTLSPRDPKAPGQFGRPVIVPPGKEKEAQKRWKEGNFNVYLSDLIPVDRAIEDTRP
AGCAEQLVHNQLPTTSIIMCFVDEVWSTLLRSVHSVLNRSPQHLIKEILLVDDFSTKDYL
KDKLDKYMSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEPLLE
RVYLSRKKVACPVIEVINDKDMRISYMTVDNFQRGVFVWPMNFGWRTIPPEVVAKNRIKE
TDVIRCPVMAGGLFSIDKNYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIVPCSRV
GHIFRNDNPYSFPKDRLKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQRLDAGNLTQQR
ELRKKLKCKSFKWYLDNVFPDLKAPIVRAGGVLVSVALSKCISVENTTVILEECDASSKS
QQFNYTWLRLIKHEEWCLAPVPDKGALKLSTCDNRNSGLKWLHILTSVFHPDLVNHIVFE
NSHQLLCLEGNFSQKTLKVAACDSMKLHQKWKFEKYYED
Download sequence
Identical sequences ENSCPOP00000000823 10141.ENSCPOP00000000823 ENSCPOP00000000823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]