SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000876 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000876
Domain Number 1 Region: 625-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-80
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 35-207
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-72
Family Ephrin receptor ligand binding domain 0.000000265
Further Details:      
 
Domain Number 3 Region: 334-542
Classification Level Classification E-value
Superfamily Fibronectin type III 4.53e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 921-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000876
Domain Number - Region: 262-332,373-393
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000118
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000876   Gene: ENSCPOG00000000977   Transcript: ENSCPOT00000000983
Sequence length 997
Comment pep:known scaffold:cavPor3:scaffold_7:49828110:49839172:1 gene:ENSCPOG00000000977 transcript:ENSCPOT00000000983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAPAPPPCLRDPASAHLLFPLGSPAKCLCLLFPAETLMDTKWVTSELAWTSHPESGWEEV
SGYDEAMNPIRTYQVCNVLESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGS
CKETFNLFYYEADSDVASASSPFWMENPYIKVDTIAPDESFSRLDAAGRVNTKVRSFGPL
SKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAETTSLVIAPGTCVAN
AVELSVPLKLYCNGDGEWMVPVGACTCATGHEPAVEESQCHPCPPGSYKAKQGEGPCLPC
PPNSRTTSPAASICTCHNNFYRADSDTADSACTTVPSPPRGVISNVNETSLVLEWSEPRD
LGGRDDLLYNVICKKCHGGPGAGGPSTCSRCDDNVEFVPRQLGLTERRVHISHLLAHTRY
TFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPEWPNG
VILDYEMKYFEKNEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSHPAEFE
TTSERGSSAQQLQEQLPLIVGSATAGLIFVVAVVVIAVVCLRKQRHSSDSEYTEKLQQYI
APGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVF
VAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDS
FLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSR
FLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWD
MSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences 10141.ENSCPOP00000000876 ENSCPOP00000000876 ENSCPOP00000000876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]