SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000933 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000933
Domain Number 1 Region: 638-878
Classification Level Classification E-value
Superfamily HCP-like 2.18e-31
Family HCP-like 0.0015
Further Details:      
 
Domain Number 2 Region: 850-964
Classification Level Classification E-value
Superfamily HCP-like 0.00000000471
Family HCP-like 0.01
Further Details:      
 
Domain Number 3 Region: 249-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000902
Family Laminin G-like module 0.053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000933
Domain Number - Region: 532-603
Classification Level Classification E-value
Superfamily HCP-like 0.000719
Family HCP-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000933   Gene: ENSCPOG00000001037   Transcript: ENSCPOT00000001046
Sequence length 1097
Comment pep:known scaffold:cavPor3:scaffold_50:9044487:9143969:1 gene:ENSCPOG00000001037 transcript:ENSCPOT00000001046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPKSNHTKPTARAGTGNFVPSLGRQTSLTTSVIPREEQSMTYEDFIYFTVFEGRVRN
VSEVSVEYLCSQPCVVNVEAVVSSEFRSSIPVYKKRWKNEKHLHTSRTQIVHVKFPSIMV
YRDDYFIRHSISVSAVILRAWITHRYSGTDLNVKWEENLPHTVAKNYTLLQTVPPFERPF
KDHQVCLGWNMGYIWKLWANKIPQCPLENDVVAFLDFPYASSGENTGIVKKLWRFQNREL
EATRCQRTDYPVFTVSLWLYLLHYCKANLCGVLYFVDSNEMYGTPSVFLTEEGHLHIQMH
LVQGEDLAVKTKFTVPLKEWFRLDISFTGGQIVITISTGQDLKSYHNQTISFYEDFHYND
TAGYFIIGGSRYVAGIEGFFGPLKYYRLRSLHPTQILNPFLEKQLAEQIELYYERCAEVQ
EIISSYASTVQLGGERQEACDLRNSYLDLRHKYGRPATCRAFPWEKGLKDKHPSLLQALL
DMDLLTVSRNQNESVLEIGGRIFEKAVKRLSRVDGLHQISSVIPFLMDSSCCGYHKASYY
LAVFYETGLNVPRDPLQGMLYSLVGGQGSERLSSMNLGYKHYQGIDNYPMDWELSYAYYS
SIAMKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRL
AQMLFWGQQGVAKNPEAAIEWYAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMK
KAASKGLHQAVNGLGWYYHKFKKNYAKAAKYWLKAEEMGNPDASYNLGVLHLDGIFPGAP
GRNLTLAGEYFHKAAQGGHIEGTLWCSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLG
HVLRRALNAYLEGFWHEALLYYVLAAETGIEVSQTNLAHICEERPDLAGRYLGVNCVWRY
YNFSVFQIDAPSFAYLKMGDLYYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIE
EGAKIPHHILDFLEIDPTLHSSNISILRELYERCWSHSTEESFSPCSLAWLYLHLRLIWG
AVLHSALIYFLGTFLLSILIAGTVQYIQSVSASSSPPVPARVSPDTTASTAAPAVTPATG
ALDQDQPTVTSNTEPRG
Download sequence
Identical sequences ENSCPOP00000000933 10141.ENSCPOP00000000933 ENSCPOP00000000933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]