SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001031 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001031
Domain Number 1 Region: 664-732
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-20
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1584-1643
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1141-1268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-16
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 4 Region: 1418-1474,1502-1510
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000706
Family TB module/8-cys domain 0.00042
Further Details:      
 
Domain Number 5 Region: 1019-1151
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000926
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1231-1350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000154
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 7 Region: 934-1056
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000146
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 611-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 1740-1822
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 547-609
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000127
Family TB module/8-cys domain 0.0032
Further Details:      
 
Domain Number 11 Region: 1483-1533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000917
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 881-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 13 Region: 854-894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000848
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1525-1572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 15 Region: 1344-1382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000566
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001031
Domain Number - Region: 188-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 396-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001031   Gene: ENSCPOG00000001143   Transcript: ENSCPOT00000001155
Sequence length 1826
Comment pep:known scaffold:cavPor3:scaffold_20:18623035:18718660:-1 gene:ENSCPOG00000001143 transcript:ENSCPOT00000001155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPRTSPARTRGSGRADPAPWRAFLPVVLALLADIGHAQRNSAGRYEPVRDASPLWRPAG
NHPAAVAAKVYSLFREQDPPVSGSLPAEQTRPAWGSPRRPAEAEARRSSRAQQLRRALPP
VQTRRSSPAGPQQPAPRARVAPALPSLGTSQRPGVPPRGRLTGRNVCGGQCCPGWTTANS
TNHCIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPEEEFDPQNSRLAPRRSAER
TPNLRRSSTAREGPEARTQALAPQLSPTREKLPAETLSALSQTRPSQQHVGLSRTVRRYP
ATGTSGQLTSNALPAGLEQRDGAQQAAHLDYLSSPWGLNLTEKIKKIKIVFTPTICKQTC
AHGRCANSCERGDTTTLYSQSGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPSNSTG
KFCHLPAPQPDREAPKRGSRHRGPLEGPVQQSTFMLPLSNQLASVNPSLVKVHIHHPPEA
SVQIHQVARVRGEADGALEENSVETRVPPRLPASPQHRHWDSNSIPARSGEPPQSPPQVV
SRRQGPLGRCYLGAVNGQCANPLMELISWEDCCNSGVGAFWGLTSCTPCPWRATSLMTKD
GQLDCPLGYYRLNVTHCQDINECVISRLCKDLECVNTRGSYLCTCRPGLMLDPSRSRCVS
DKAVSMQQGLCYRSLGSGTCTLPLAQKITKQICCCSRVGKAWGSKCEKCPLPGTEAFGEI
CPAGHGYTYSSSDIRLSMRKAEEEELARPSREQAQKSSGALPVLEERQPLQAVTNTWLEA
ETIPDKGDSQAGQVTTNVTHPFAWVPVDAIGRSTPPLPEQRVPDTQEEEHMAPSADVLVT
SAPPGTDRCASGATNICGPGTCVNLPDGYRCVCNSGYRLHPSQAYCTDDNECLKDPCAGR
GHCVNSVGSYSCLCYPGYTLATSAATQECQGKGECECPAGVCRAGRWEAVHPTKGAYHRE
CDPGYTLVRKGGCQNIDECRQPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECL
TPGVCAHGRCINLEGSFRCSCEQGYEVTSDKKGCQDVNECASRASCPKGLCLNTEGSFTC
TACESGYWVNEDGTACEDLDECTFPGVCPAGVCTNTVGSFSCKDCEEGYRPSPLGRTCED
VDECEDPHSSCLGGECKNTAGSYQCLCPPGFQLANGTVCEDVDECTGKEHCAPHGECLNS
HGSFFCLCAPGFASEEGGTSCQDVDECAAADPCLGGHCVNTEGSFNCLCEAGFRPSPESG
QCVDVDECEDYAEPVCGAWKCENSPGSYRCVPGCQPGFYMAPTGDCIDIDECANDTVCGS
HGFCDNTDGSFRCLCDQGFETSPSGWDCIDVNECELMLAVCGAALCENVEGSFLCLCASD
MEEYDAQEGLCRPRVAGAQSISEAPTGDHASGPIRMACYSGQDGHLPCSSILGHNSTQAE
CCCTQGARWGDACDLCPSEDSVEFSELCPSGKGYVPVEGDWTFAQTMYTDADECMLFGSA
LCQNGRCLNTVPGYICLCNPGYHYSVSRGQCEDHNECQDMACENGECVNTEGSFHCFCSP
PLTLDFSGQRCMNSTSGMEDLPDHDIHVDICWKKVTNDVCSQPLRGRQTTYTECCCQDGE
AWSQQCALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSLYGPDGAP
FYNYLGPEDSVLEPPFSNTARNPGSPSLVLEPPLQPSELQPQYVASHPDPPAAFEGLQAE
ECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAALCAHGHCEN
TEGSYRCHCSPGFVAKPDPPHCAAKE
Download sequence
Identical sequences ENSCPOP00000001031 10141.ENSCPOP00000001031 ENSCPOP00000001031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]