SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001279 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001279
Domain Number 1 Region: 151-273
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-32
Family C-type lectin domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001279   Gene: ENSCPOG00000001415   Transcript: ENSCPOT00000001434
Sequence length 277
Comment pep:known scaffold:cavPor3:scaffold_0:6634286:6670072:-1 gene:ENSCPOG00000001415 transcript:ENSCPOT00000001434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSRVLLRSNQFILLLLFLLQIQSLGLDIDSRPTVEVCATHAISPGPKGDDGERGDPGE
EGRDGKVGRRGPKGIKGELGDTGPQGSIGKSGPIGKKGDKGEKGLLGIPGVKGKAGTVCD
CGRYRKVVGQLDISVARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKSYRESLTHCRIRG
GMLAMPKDEAINTLIADYVAKSGLFRVFIGVNDLEKEGQYVFTDSTPLQNYSNWQEGEPS
DPYGHEDCVEMLSSGRWNDTECHRTMYFICEFVKEKK
Download sequence
Identical sequences A0A286Y2F7
ENSCPOP00000001279 ENSCPOP00000001279 10141.ENSCPOP00000001279 XP_003479873.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]