SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001526 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001526
Domain Number 1 Region: 12-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 126-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-37
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 311-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 553-611
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000335
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 524-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000749
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001526   Gene: ENSCPOG00000001691   Transcript: ENSCPOT00000001712
Sequence length 668
Comment pep:known scaffold:cavPor3:scaffold_10:1366269:2077204:-1 gene:ENSCPOG00000001691 transcript:ENSCPOT00000001712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEKCDEPLVSSLPHVAFSSSSSMSSSYAPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGN
RKQISAIGTQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNVNSDSVVRHDLQ
HPVIARYVRVVPLDWSAEGRIGLRVEVYGCAYWADVINFDGHVVLPYRFRNKKMKTLKDV
ISLKFKTSESEGVILHGEGQQGDYITLELQKAKLVLSLNLGSNQLGPIYGHTSVMTGSLL
DDHHWHSVVIERQGRSINLTLDRSLQHFRTNGEFDYLDLDYEITFGGIPFSGKPSSSSRK
NFKGCMESMNYNGINITDLARRKKLEPSNVGNLSFSCVEPYTVPVFFNATSYLEVPGRPE
QDLFSVSFQFRTWNPNGLLLFSHFGDNLGNVEIDLIDSKVGVRINVTQTKMSQIDISSGS
GLNDGQWHEVRFLAKENFAILTIDGDEASAVRTNSPLQVKTGEKYFFGGFLNQMSNSSHS
VLQPSFQGCMQLIQVDDQLVNLYEVAQRKPGSFANVSIDMCAIIDRCVPNHCEHGGKCSQ
TWDSFKCTCDETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDGSGPLGPLKVYCNM
TEDKVWTIVSHDLQMPTTVVGYTPEKYSVTQLVYSASMDQISAITSSAEYCEQYVSYFCK
MSRLLNTP
Download sequence
Identical sequences ENSCPOP00000001526 ENSCPOP00000001526 10141.ENSCPOP00000001526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]