SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001560 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001560
Domain Number 1 Region: 23-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.64e-40
Family Galectin (animal S-lectin) 0.00028
Further Details:      
 
Domain Number 2 Region: 187-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-16
Family Galectin (animal S-lectin) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001560   Gene: ENSCPOG00000001729   Transcript: ENSCPOT00000001750
Sequence length 314
Comment pep:known scaffold:cavPor3:scaffold_44:14771836:14778269:1 gene:ENSCPOG00000001729 transcript:ENSCPOT00000001750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEKLDPIPDNFILQPPAFHPVVPYVTTIFGGLHAGKMVVLQGAVPRDARRFQVDFQC
SCSLDPRPDIAVHFNPRFHTTRPHVICNTLHGGYWQMETRWPGLALQRGASFLLLFLFGN
EEVKVSVNGQHFLHYRYRLPLSRVDTLGIFGDISVQAVGFLNISPFAEGSREYPTGHPFL
LQSPELELPCSRTLPQGLWPGQVIIVRGLVLQEPKTFTLSLRDEAAHTQVMLRACFMDRT
LAWVSPWGRKTLISAPFLFHPQRFFEVLLLCQEGELKLALNGQGLGATSLSQQSLERLRE
LQVRGNIQLYCIHC
Download sequence
Identical sequences A0A286Y162
ENSCPOP00000001560 ENSCPOP00000001560 XP_003467951.1.53824 10141.ENSCPOP00000001560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]