SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001760 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001760
Domain Number 1 Region: 55-194
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-35
Family C-type lectin domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001760   Gene: ENSCPOG00000001952   Transcript: ENSCPOT00000001974
Sequence length 196
Comment pep:known scaffold:cavPor3:scaffold_118:2668462:2674359:-1 gene:ENSCPOG00000001952 transcript:ENSCPOT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNGLVICILVISLLLDQTTSLRSKLKTRKHSKRRVKEKDGDLKSQVEKLWREVNALKE
IQALQTVCLRGTKFHKKCYLASEDLKHFHEANEDCISKGGTLVVPRDSDEINALRDYGKR
SLPGVNDFWLGINDMATEGKFLDVNGMAVSFLNWDRAQPNGGKKENCVLFSQSAQGKWSD
EVCRSSKRYICEFTIP
Download sequence
Identical sequences A0A286XHC0
ENSCPOP00000001760 XP_003462899.1.53824 ENSCPOP00000001760 10141.ENSCPOP00000001760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]