SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001828 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001828
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-67
Family Ephrin receptor ligand binding domain 0.000000306
Further Details:      
 
Domain Number 2 Region: 666-871
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-53
Family Protein kinases, catalytic subunit 0.0000000264
Further Details:      
 
Domain Number 3 Region: 281-486
Classification Level Classification E-value
Superfamily Fibronectin type III 7.78e-39
Family Fibronectin type III 0.00000261
Further Details:      
 
Domain Number 4 Region: 865-936
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-19
Family SAM (sterile alpha motif) domain 0.00016
Further Details:      
 
Domain Number 5 Region: 211-284,319-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000157
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001828   Gene: ENSCPOG00000002021   Transcript: ENSCPOT00000002048
Sequence length 941
Comment pep:novel scaffold:cavPor3:scaffold_8:32018690:32277612:1 gene:ENSCPOG00000002021 transcript:ENSCPOT00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPN
VPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTE
VRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIA
RGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEA
EGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPDVACTSVPSGPRNVISIVNETSIILE
WHPPRENGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTP
YIFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPN
GIILDYEIRYYEKENNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKM
CFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQH
YSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGSFYEHWKEGHIDG
RRKINKIIESIEASVEREIDDFVSSEIISCCYHRSNRSHLRAVSSAFLPWLVMREKRQSW
VNTGGIQQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDF
GLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGER
PYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIR
NPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDEWLGAIKMVQYRDSFLTAGFTSLQLV
TQMTSEDLLRIGVTLAGHQKKILNSIHSMRVQMSQSPTAMA
Download sequence
Identical sequences 10141.ENSCPOP00000001828 ENSCPOP00000001828 ENSCPOP00000001828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]