SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002077 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002077
Domain Number 1 Region: 25-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.02e-47
Family MHC antigen-recognition domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family C1 set domains (antibody constant domain-like) 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002077   Gene: ENSCPOG00000023679   Transcript: ENSCPOT00000002318
Sequence length 333
Comment pep:known scaffold:cavPor3:scaffold_56:7633477:7636322:1 gene:ENSCPOG00000023679 transcript:ENSCPOT00000002318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLALALLAFLFPAGDTQNALQWPTSVHGIQISSFFNHTMAQSRCSGWLGNMELGSFDS
DTGTIIFKKPWSKANFSNEEVLELEELFQVYMLGFIREVQERMSDFQMEYPFEIQGIAGC
ELISGGTIDFFLRGALEGLDFLSIKNSTCWPAPEGGTKAKKFCTLILQYKGIWDIMENLL
TKTCPRYVLSVLESGKPDIQKQVKPDAWLSQGPSPGPGLLQLVCHVSGFYPKPVWVMWMR
GEQEQPETQKGDVLPNADETWYLQVTLDVAAEEAAGLSCRVKHSSLEGQDIILYWGHSIS
IGWIILAVLVPCLIVLVLFVLWFYRRWSYEDIL
Download sequence
Identical sequences H0UY75
10141.ENSCPOP00000018732 ENSCPOP00000002077 ENSCPOP00000018732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]