SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002153 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002153
Domain Number 1 Region: 22-207
Classification Level Classification E-value
Superfamily PR-1-like 2.09e-41
Family PR-1-like 0.00031
Further Details:      
 
Domain Number 2 Region: 310-442
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-28
Family C-type lectin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002153   Gene: ENSCPOG00000002368   Transcript: ENSCPOT00000002401
Sequence length 452
Comment pep:known scaffold:cavPor3:scaffold_22:2956543:2965711:1 gene:ENSCPOG00000002368 transcript:ENSCPOT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLGSSPGRGGQGHQPAILSVLLALLGIAWAEVWPPQLPEQKSVPGALSRKESFLLLSL
HNRLRSRVQPPAANMRRMDWSENLAQLAQARAALCGMPAPDLASAPRRTQQMGWNMQLLP
EGSVSFVEVINLWFAEGQWYSHETAECARNSTCTHYTQLVWATSSQLGCGQHLCSVGQAA
MEAFVCVYSPGGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRM
SCRNHGYLNISTCHCHCSPGYTGRYCQVRCSVQCIHGHFREEECSCVCDVGYGGAQCATK
VRFPFHTCDLRIDGDCFTVSSEADTYYGAKMKCQGKGGVLAQIESQKVQDILAFYLDRLE
PTNEVTDSDFETRNFWIGLTYKMAKDSFRWTTGEHQSFTSFAFGQPDNQGFGNCVELQAS
SAFNWNDQRCKTRNRYICQFAQEHISRWDPGP
Download sequence
Identical sequences ENSCPOP00000002153 ENSCPOP00000002153 XP_003472165.1.53824 10141.ENSCPOP00000002153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]