SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002167 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002167
Domain Number 1 Region: 132-243
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-31
Family C-type lectin domain 0.00000985
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002167
Domain Number - Region: 106-128
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00144
Family Triple coiled coil domain of C-type lectins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002167   Gene: ENSCPOG00000002383   Transcript: ENSCPOT00000002416
Sequence length 245
Comment pep:known scaffold:cavPor3:scaffold_15:4680345:4683971:-1 gene:ENSCPOG00000002383 transcript:ENSCPOT00000002416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFSAFLLLLLSISKTHSESVPSENAQTCPVIACGSPGLNGFPGKDGHDGAKGEKGEPG
QGLRGLQGPPGKLGPPGPPGVPGTRGLTGQKGDPGVCPVCDTSMADREKNALRNELEKIK
KWLFFSLGKKVGKKFFLSSGQQMSFDKVKALCAQFQGSVASPKNAEENRAIKNVVGEHAF
LGITDEENEGQFVDMEGKRLTYTNWNTGEPNNSDSGEDCVVLLSDGKWNDIPCSSVSKVV
CEFSV
Download sequence
Identical sequences H0UYF7
10141.ENSCPOP00000002167 ENSCPOP00000002167 ENSCPOP00000002167 XP_003473612.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]