SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002335 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002335
Domain Number 1 Region: 153-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 296-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000414
Family EGF-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002335
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 334-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0008
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002335   Gene: ENSCPOG00000002568   Transcript: ENSCPOT00000002602
Sequence length 494
Comment pep:novel scaffold:cavPor3:scaffold_48:8720588:8788149:1 gene:ENSCPOG00000002568 transcript:ENSCPOT00000002602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKVLFLTMLTLALVKAQDTEETITYTQCTDGYEWDPLRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQPQQETPAAEASSGATTGGVSASSMAASAVVPGGGF
VASAAAVVGPEVQTGRNNFVIRRNPADPQRMPSIPSHRIQCPAGYEQSEHNLCQDTDECT
AGTHNCRADQVCINLRGSFACQCLPGYQKLGEQCVDIDECAVPEVYDFEMVPTNVKLNGC
SPMSFCKAKNSAFLSDINECDASNKCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDEC
RTSNYLCQYQCVNEPGKFSCMCPQGYQVVGRTCQDINECETTNECREDEMCWNYHGGFRC
YPRNPCQDPYVLTAENRCVCPVSNAMCRDLPQSMLYKYMSIRSDRSAPSDIFHIQATTIY
ANTINTFRIKSGNENGEFYLRQTSAVGAMLVLVKSLSGPREIVVDLEMLTVNSLGTYRAS
SVLRLTIIVGPFAF
Download sequence
Identical sequences ENSCPOP00000002335 ENSCPOP00000002335 10141.ENSCPOP00000002335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]