SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002433 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002433
Domain Number 1 Region: 123-453
Classification Level Classification E-value
Superfamily Subtilisin-like 2.36e-91
Family Subtilases 0.000000000969
Further Details:      
 
Domain Number 2 Region: 452-602
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-44
Family Proprotein convertase P-domain 0.0000765
Further Details:      
 
Domain Number 3 Region: 779-943
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.96e-30
Family Growth factor receptor domain 0.00065
Further Details:      
 
Domain Number 4 Region: 633-792
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.29e-30
Family Growth factor receptor domain 0.00016
Further Details:      
 
Domain Number 5 Region: 34-106
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 8.67e-25
Family Prohormone convertase 1 pro-domain 0.0022
Further Details:      
 
Domain Number 6 Region: 931-1042
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.96e-17
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1053-1147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000228
Family Growth factor receptor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002433   Gene: ENSCPOG00000002680   Transcript: ENSCPOT00000002714
Sequence length 1147
Comment pep:known scaffold:cavPor3:scaffold_21:26909451:27304531:1 gene:ENSCPOG00000002680 transcript:ENSCPOT00000002714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGSRCCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKISGGFSEADRIASKYGFIN
IGQIGALKDYYHFYHSRTIKRSVLSSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDLNRA
QSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDL
MQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGG
VRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRR
GLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSS
GESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRA
GHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPQQHVCVESTDRQIKTIRP
NSAVRSIFKASGCSDNPNHYVNYLEHVVVRVTITHPRRGDLAIYLTSPSGTRSQLLANRL
FDHSMEGFKNWEFMTIHCWGEQAAGDWILEVYDTPSQLRNFKTPGKLKEWSLVLYGTSEQ
PYSPTNEFPKVERFRYSRVEDPTEDYGAEDYAGPCDPECSEVGCDGPGPDHCSDCLHYYY
KLKNNTRICVSSCPPGHYHADKKRCRKCAPSCESCFGSHSDQCLSCKYGYFLNEETNSCV
VHCPDGSYQDTKKNLCRKCSENCKTCTEPHNCTECRDGLSLQGARCSVTCEDGWYFNGQD
CQPCHRFCATCVGAGADGCINCTEGYFMEEGRCVQSCGISYYLDQSAEHGYKFCKRCDTS
CLTCHGPGFKDCTSCPSGYLLDLGTCQLGAICKDGEYTDEHGRCQACDASCAKCRGPSQE
ECTSCFRTRVLDDGHCVLNCPSWKFEFQNRCHPCHHTCRGCRGSGPSSCTSCGADKQGRE
RFLHQGECLESCPAGHAPAQGHTCLPCPDNCELCHHPHICTRCVSGYVLGPTNSTCEKLE
CGQGEVQDSDYEECLPCEEGCLGCTSGMFLPASFCASLPPRFEHRCYRACPEKTFAEERE
CRACSAHCGSCSRHECFWCEQSFFLLGRCSRECAAIEYWDEDTHRCKPCHRRCFHCTGPA
EDQCRSC
Download sequence
Identical sequences 10141.ENSCPOP00000002433 ENSCPOP00000002433 ENSCPOP00000002433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]