SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002456 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002456
Domain Number 1 Region: 104-265
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-19
Family C-type lectin domain 0.0061
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002456
Domain Number - Region: 264-329
Classification Level Classification E-value
Superfamily FnI-like domain 0.00157
Family VWC domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002456   Gene: ENSCPOG00000002706   Transcript: ENSCPOT00000002740
Sequence length 549
Comment pep:known scaffold:cavPor3:scaffold_4:18287471:18343570:-1 gene:ENSCPOG00000002706 transcript:ENSCPOT00000002740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGAIQCIPLSWHCDGLPTCEDE
SDEANCPEVTRESRPYHGKESVDLRQGRARGGDPTHFHAVNVAQPVRFSSFLGKCPTGWH
HYEASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFVLAQEWDQPELVPFGWKDQ
RKLWVGYQYVVTARNPSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVYCAQLQCFHF
PTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGG
EPEMCVAALCEGPQGCQQYRKEPKECCKFMCLDPDGNNLFDSMASGMRLVVSCISSFLIL
SLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDRFGTGLTPLHLSDDGEG
GTFHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPADDDAFDPAEASPPNPG
DGCSEGALPQCLEQPLPTSGASLADLEDSADSSSVLLVPPDPTQSGNIPAAEAPPGGGRP
SRGSLNTVV
Download sequence
Identical sequences A0A286XPB7
XP_005007363.1.53824 10141.ENSCPOP00000002456 ENSCPOP00000002456 ENSCPOP00000002456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]