SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002478 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002478
Domain Number 1 Region: 425-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-39
Family SPRY domain 0.0005
Further Details:      
 
Domain Number 2 Region: 231-422
Classification Level Classification E-value
Superfamily Fibronectin type III 6.74e-24
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 3 Region: 32-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000733
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002478
Domain Number - Region: 66-185
Classification Level Classification E-value
Superfamily Tropomyosin 0.0562
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002478   Gene: ENSCPOG00000002729   Transcript: ENSCPOT00000002763
Sequence length 608
Comment pep:known scaffold:cavPor3:scaffold_10:32763773:32795468:1 gene:ENSCPOG00000002729 transcript:ENSCPOT00000002763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSQALWESYRYTHGRASEEYECYVIPEEEDEEEAADLFCVTCRTPIRAVEKDFGEHKEHE
VTPLSKALESAKEEIHKNMYKLEQQIIEMENFASHLEEVFITVEENFGRQEQNFESHYNG
ILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLDTCKELMETIEEMCHEEKVDFL
KDALAMTDRLGKFLKTKTDVEIAAQPEFEDQTLDFSDVEQLMGSMNTILAPSAPVINPQA
PNSATGSSVRVCWSLYADDTVESYQLSYRPVRDSLPGKEQAEFTVTVKESYCSVTNLEPN
TQYEFWVIAQNRAGPSPSSEHAMYMTAPSPPIIKTEAIRSCEEAALICWESGNLNPVDSY
TVELTQVEEPAASGVTESVVGIPICESLIQLQPGQSYTICVRALNVGGPSARSTPATVRT
TGSYFPLNKATCHPWLTISEDGFTVIRSERKNLTQELQPQQTQFTRCVAIMGNLIPVRGR
HYWEIEMDEHLDYTVGVAFEDVPKQEDLGANGFSWCMRHTFASSRHKYEFLHNRTTPDIR
ITVPPKKIGILLDYENSKLSFFNVDIAQHLYTFSCQLQQFVHPCFSLEKPGCLKIHNGIS
MPMHATFY
Download sequence
Identical sequences ENSCPOP00000002478 10141.ENSCPOP00000002478 ENSCPOP00000002478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]