SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002770 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002770
Domain Number 1 Region: 149-264
Classification Level Classification E-value
Superfamily C-type lectin-like 5.31e-43
Family Link domain 0.0049
Further Details:      
 
Domain Number 2 Region: 639-772
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-43
Family C-type lectin domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 265-359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-30
Family Link domain 0.0096
Further Details:      
 
Domain Number 4 Region: 44-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000274
Family V set domains (antibody variable domain-like) 0.075
Further Details:      
 
Domain Number 5 Region: 766-825
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000111
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 601-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002770   Gene: ENSCPOG00000003060   Transcript: ENSCPOT00000003101
Sequence length 864
Comment pep:novel scaffold:cavPor3:scaffold_10:17206032:17216909:1 gene:ENSCPOG00000003060 transcript:ENSCPOT00000003101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLLALMAALAMARVLEADVLDTDSSEDRAFRVRIAGAHAAPLQGVLGGDLTIPCYVH
ALRPRGRAAPGSPRVKWTFLAGGRETEVLVARGLRVKVSEAYRFRVALPAYPASLTDVSL
VLSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACARI
GARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDP
DDLYDVYCYAEDLNGELFLGAPPDKLTLEEAQEYCRERGAEIATTGQLYAAWDGGLDRCS
PGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAHPSAI
PGVSNSASDGLEAIVTVTETLEELQLPLEAMESESRGAIYSIPIMEDGGGGSSTPEDPAE
APRTLLEFKTASTVPPTGSYAWVWPGELSSPVPMEESENSLSQASSVLQPGTLSPPDGQS
EAPRSPRLRRPPTETLPTTKEGSLASLLPFTPAGAREEGEETGGPELSGVPQGESEEAGS
SEDTPPLLPATPALEGTRDLEAPPEENSGRSTPAGTSVQAPPVLPTDSASQGGVAVAPSS
GDCIPNPCHNGGTCLEEEEGIRCLCLPGYGGHLCDIGLRSCSPGWDSFQGACYKHFAARR
SWEEAESQCRRLGAHLASVRTPEEQAFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYE
NWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVF
GSPRLRYEVDTVLRYRCRKGLVQRNLPLIRCREDGSWESPRISCVPRRTARALHPVKTSE
EYQERLPGYWRALLTPPSGPTPGS
Download sequence
Identical sequences ENSCPOP00000002770 10141.ENSCPOP00000002770 ENSCPOP00000002770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]