SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002772 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002772
Domain Number 1 Region: 563-788
Classification Level Classification E-value
Superfamily vWA-like 4.45e-62
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 3-191
Classification Level Classification E-value
Superfamily vWA-like 7.23e-57
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 193-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.83e-18
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 357-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 315-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000164
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 480-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 864-907
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000131
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002772   Gene: ENSCPOG00000003062   Transcript: ENSCPOT00000003103
Sequence length 910
Comment pep:known scaffold:cavPor3:scaffold_0:17989731:18065177:-1 gene:ENSCPOG00000003062 transcript:ENSCPOT00000003103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESTCENKRADLVFIIDSSRSVNTQDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKN
EFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMI
VTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIES
LTSVFQNKLCTAHMCSILEHNCAHFCINTPGSYECRCKQGYILHADQKTCRIQDLCALED
HACEQLCVNVPGSFVCQCYSGYSLAEDGKRCVAVDYCGSEDHGCEHMCVNADGSYLCKCR
EGFALNPDKKTCTKIDFCASPTHGCQHECVNTDTSYACRCLKGFMLNPDKKTCRRINYCA
LNKPGCEHECVNTEESYYCRCRRGYTLDPNGRTCSRVDHCAQDHDCEQLCLNTEESFVCQ
CSEGFLINEDLKTCSRADYCLLSDHGCEYACVNTDRSFACQCPEGHVLRSDGKTCAKRDP
CAAGDHGCEHSCVSSEDSFECRCFEGFLLRDDGKTCKRKDFCQDVAHGCEQVCVSSDKSY
TCKCLEGFRLAEDGKRCKRKDICSSSSHGCEHICVNKGDSYVCRCSPGFILAEDGRRCKR
CTEGPVDLIFVIDGSKSLGEDNFEIVKQFVTGIIDSLAISPKAARVGLLQYSTQVRPEFT
LRSFQSAKDMRKAVAQMKYMGKGSMTGLALKHMFERSFTPAEGARPLSARVPRVAIVFTD
GRAQDDVSEWANKAKAHGIEMYAVGIGKAIEEELQEIASEPATKHLFYAEDFSSMGQISA
KLKQGICEALEDSDGRQDSPVGDLPKRGHQPTASEPVTINIQDLLSCSNFAVQHRYLFEE
DNLPQSTQKLSHSTKSSGNLLEEKHDQCKCENLITFQNLANEEVRKLTQRPLLEEMTQRM
EALENRLRTR
Download sequence
Identical sequences ENSCPOP00000002772 10141.ENSCPOP00000002772 ENSCPOP00000002772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]