SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002774 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002774
Domain Number 1 Region: 605-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-83
Family Protein kinases, catalytic subunit 0.000000000149
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-66
Family Ephrin receptor ligand binding domain 0.00000938
Further Details:      
 
Domain Number 3 Region: 328-527
Classification Level Classification E-value
Superfamily Fibronectin type III 5.14e-30
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 897-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.33e-19
Family SAM (sterile alpha motif) domain 0.00083
Further Details:      
 
Domain Number 5 Region: 257-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000011
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002774   Gene: ENSCPOG00000003065   Transcript: ENSCPOT00000003106
Sequence length 976
Comment pep:known scaffold:cavPor3:scaffold_25:17867808:17895906:1 gene:ENSCPOG00000003065 transcript:ENSCPOT00000003106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEYRAVRACLALLWGCAMVAAAVAQGKEVVLLDLAEAKGELGWLTYPYGKGWDLAQNIMD
DMPIYMYTVCNVVTGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYFESDMDYGTNFQKRHFTKIDTIAPDEITLTSDFEARHVKLNVEERTVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPEMVQGLARFPETIAGSDAPSLATVAGTCVEHAVVLPGG
EEPRMHCAVDGEWLVPIGQCLCEEGYEKVEDTCQACSPGFFKSQASESPCLQCPAHTLPS
LQGATSCECEEGYFRAPEDALSTPCTRPPSAPHYLTAVGMGAKVELRWTPPQDTGGREDI
VYRVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRTTTSLTVTWSIPVPQRSRVWKYEVTYHKKGDAN
SYNVHRTEGFSVTLENLAPDTTYLVQVQALTQEGQGAGSKEHEFQTLSLEGSSNMAMIGG
VAVGVILLLVLAGIGFFIHHRRRRLRARQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCITRQKVIGAGEFGEVYKGTLKSSSGKKEVPVAIKTLKAGYTEKQRVDF
LSEASIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPNSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTSEDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
Download sequence
Identical sequences A0A286XZ18
ENSCPOP00000002774 ENSCPOP00000002774 10141.ENSCPOP00000002774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]