SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002867 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002867
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-104
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-34
Family TSP type-3 repeat 0.00000379
Further Details:      
 
Domain Number 3 Region: 516-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000144
Family Assembly domain of cartilage oligomeric matrix protein 0.0018
Further Details:      
 
Domain Number 5 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000641
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 309-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 53-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000475
Family Laminin G-like module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002867
Domain Number - Region: 363-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 415-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 275-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0436
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002867   Gene: ENSCPOG00000003165   Transcript: ENSCPOT00000003208
Sequence length 956
Comment pep:known scaffold:cavPor3:scaffold_10:16106747:16117205:-1 gene:ENSCPOG00000003165 transcript:ENSCPOT00000003208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGGLGLLFLCSFASASQDLQVIDLLTVGESRQMVAVVEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNIRWLETSVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPSLQLYVDCKLGDQHTGLPALAPIPPAEVSGMEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAGCDPLHTPTGEQTKALVTQLTLFNQ
ILVDLRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFQGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCADINECAHAEPCFPGSSCINTMPGFHCETCPRGYKGTQVSGVGIDY
ARASKQVCSDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQTQGCLPVRTCHS
PAHSPCHVHAHCLFEHNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences 10141.ENSCPOP00000002867 ENSCPOP00000002867 ENSCPOP00000002867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]