SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002903 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000002903
Domain Number - Region: 231-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 456-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0424
Family Growth factor receptor domain 0.0025
Further Details:      
 
Domain Number - Region: 363-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 622-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 404-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 665-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Integrin beta EGF-like domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002903   Gene: ENSCPOG00000003205   Transcript: ENSCPOT00000003248
Sequence length 1042
Comment pep:known scaffold:cavPor3:scaffold_10:17446586:17456223:1 gene:ENSCPOG00000003205 transcript:ENSCPOT00000003248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPLRFLLLLALDLGLSRTLNSNDPNTCSFWESFTTTTKESHSRPFSLFPLEPCNKPWE
DLHTCPQPTVVYRTVYRQVVKTDYRLRLRCCQGFYESSGICIPVCAQECVHGRCVAPNQC
QCVPGWRGNDCSSACGPEMWGLQCDQFCHCGNNSSCDPTSGVCSCPSGLQPPNCLQPCTP
GHYGPACRLQCQCHGASCDPQTGACFCPPGKTGPSCGVSCLQGTAGFLCPITSPCQNGGI
FQVHQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCHCAPGYTGD
RCREECPVGSFGQDCNGTCDCAPGAHCFPANGACLCEHGFTGHRCAERLCPDGLYGLSCQ
TACTCDPEHSLSCHPMHGECACRPGWAGLHCNESCPRDTHGPGCQEHCLCLNGGVCLADS
GLCRCEPGYTGPHCASLCPPNTYGVNCSSRCSCENAVTCSPVDGTCVCKEGWQRGNCSVP
CPPGTWGFSCNASCQCANEGVCSPQTGACTCTPGWHGAHCQLPCPKGQFGKDCADRCDCD
HSDGCDPVNGHCQCQAGWTGTHCHLPCPEGFWGANCSNACTCKNGGTCLPENGNCVCAPG
FRGPSCQRSCQPGRYGKRCVPCKCNNHSSCHPVNGTCYCLAGWTGPDCSQPCPTGHWGIN
CAQSCQCQHGGTCYPQDGSCICTSGWTGQYCSEVCPPGMFGANCSQPCECGPGEKCHPET
GACVCPPGYSGAPCRIGSQEPFTMMPTSPVAYNSLGAVIGIAVLGSLVVALIALFIGYRH
WQKGKEHQHLAVAYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPSPLPPNKVPG
SQLFASLQVPERSSGAHRHDNHTTLPADWKHRVESPLASLDRGSSRLDRSYSYSYRHGNG
PGLISNKALGSISEEGLGTSLASLSSENPYATIRDLPSLPGGPRESSYVEMKGPPSASPP
RQSVQRQNSQRCWQPQPQRDSGTYEQPNPLTLDRDSMASQPPLPPGLPPGHYDSPKNSHI
PGHYDLPPVRHPPSPPLRRQDR
Download sequence
Identical sequences ENSCPOP00000002903 10141.ENSCPOP00000002903 ENSCPOP00000002903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]