SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002924 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002924
Domain Number 1 Region: 3107-3211
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.95e-27
Family Colipase-binding domain 0.095
Further Details:      
 
Domain Number 2 Region: 393-530
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-26
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 3 Region: 66-154
Classification Level Classification E-value
Superfamily L domain-like 8.33e-22
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 4 Region: 2016-2138
Classification Level Classification E-value
Superfamily PKD domain 2.51e-20
Family PKD domain 0.0024
Further Details:      
 
Domain Number 5 Region: 1675-1796
Classification Level Classification E-value
Superfamily PKD domain 3.6e-20
Family PKD domain 0.0056
Further Details:      
 
Domain Number 6 Region: 1080-1202
Classification Level Classification E-value
Superfamily PKD domain 4.19e-18
Family PKD domain 0.0041
Further Details:      
 
Domain Number 7 Region: 260-352
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000157
Family PKD domain 0.0000453
Further Details:      
 
Domain Number 8 Region: 1469-1537
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000183
Family PKD domain 0.0041
Further Details:      
 
Domain Number 9 Region: 1214-1284
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000196
Family PKD domain 0.0053
Further Details:      
 
Domain Number 10 Region: 1303-1371
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000301
Family PKD domain 0.0046
Further Details:      
 
Domain Number 11 Region: 1543-1623
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000432
Family PKD domain 0.01
Further Details:      
 
Domain Number 12 Region: 1003-1115
Classification Level Classification E-value
Superfamily PKD domain 0.000000000123
Family PKD domain 0.0055
Further Details:      
 
Domain Number 13 Region: 1882-1963
Classification Level Classification E-value
Superfamily PKD domain 0.00000000275
Family PKD domain 0.011
Further Details:      
 
Domain Number 14 Region: 1382-1454
Classification Level Classification E-value
Superfamily PKD domain 0.00000000484
Family PKD domain 0.006
Further Details:      
 
Domain Number 15 Region: 1807-1880
Classification Level Classification E-value
Superfamily PKD domain 0.00000000876
Family PKD domain 0.0068
Further Details:      
 
Domain Number 16 Region: 895-1005
Classification Level Classification E-value
Superfamily PKD domain 0.00000458
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002924   Gene: ENSCPOG00000003228   Transcript: ENSCPOT00000003271
Sequence length 4284
Comment pep:known scaffold:cavPor3:scaffold_4:22183431:22229839:-1 gene:ENSCPOG00000003228 transcript:ENSCPOT00000003271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPEPRPSVCRRALGRRGHERAALTMPPGAPARCLCGPAPGASCRVNCSGRGLRKLGPELR
IPADTTVLDVSHNLLQTLDVGLLANLSALVELDISNNRISTLEEGIFANLFNLSEINLSR
NPFECDCGLVWLRHWAEEKQVLVVQPEEATCTGPGPLAGQPLLGLSLVDTGCGEEYVACL
PDNSSDTMVLVAFSIAHEGPLAPEACSTFCFLGGQGLAALSEQGQCLCGTAQTPNISVAC
LSLCSNPLPPTPACGGPTFLQHVFPSSPGTTLVGPHGPLASGQPAAFHISTTSLPLSTIC
WDFGDGSPKLDMAGPAATHRYVLPGHYHVTAVLTLGASSITLETEVQVEVAPAALELVCP
SSVHRDESLELSIRNRGGSDLEATYSILALGEEPVQVVHPLCPSDTEIFPGNGHCYRLVA
EKAPWLQAQEQCQAWAGAALAMVDSPAIQHFLVSQVTRSLDVWIGFSTVEGAEAGLAPQG
EAFSLESCQNWLPGEPHPATAEHCVRLGPAGQCNTDLCSAPHSYVCELRPGGPVWDAENF
LMGVPGGGLQGPLILLTPQEALLPPRWPVEVMVFPGLSPSREAFLTTAEFETQELGGPAQ
LRLQVYRPSGRAGAPENRSEPDNRTEPVPRCMPEGCWCPGASLCMPLDAACHLQACANES
VVEPGLPRATYALWREFLFSVPAGPPTQYLVTFHGQDVPVLPGDLIGLQHDAGSGALLQC
PLTPNQAGSKVLYLSTNASNWLAHLPTLLDDARPGPACILQLVTATERLSPLLGLRSNPG
LQHPGRYEVRATVGNNVSTYNLSCSFNVVSPVAGLRVIYPATLDGQLYVPTSGSVLVLQV
DSGANATATAYWPGGNVSAPLETACPTMLDALKPICTQETNNTLFSVLVLPGLSQGEHAV
DVVVQNSAGRANLTLRVMAEEPIRGLHATPVPEARVLQGALVRYSPMVEAGSNVVFRWTI
DDKQSLTFHNVVFNVIYQSAAIFKLSLTASNHVSNVTVNYNVTVERMNKMRSLQVSAVPA
VLASNTMLALMASVMVDSAVEVAFLWTFGDGQQVLGQFKPPYNKSFQVPDPTVAQVLVEH
NVTHTYTNAGEYNLTVLVSNAFENLTQQVPVSVRDTLPAVAISVSSSTLVAGWPVIFSLY
PLPLPGGVLYMWNFGDDSPVLIQSQPMVNYTYTRTGTYHICLEVNNTVSSVVAHTDVHVF
QELSGLSVQLSPAVEQGAPVVVSATVETGDNVMWTFDMGDGTVFTGPEATVQHIYLRAQN
YTVTVNAASPAGHLTQSLPVRVFVLEVLRIEPATCIPTQPEAQLTAHVAGNPAHYLFDWT
FGDGSSNTTVQGHPTVTHNFTRSGIFPLVLILSSHVNKAHYFTSVCVEPEVENVTLQPEQ
QFVQLGDEARLVACPWPHFPYRYTWDFGIEDTVPTHDWGPEATVVYRDPGSYLVTVTVSN
NVSAVNDSALVEVQEPMVVTGIRVNGSHVLELQQPYLFSAMGHGHPATYLWELGDGAQLV
GPEITHVYNSTGDFTIRVLGWNDVSHSEAWLNVTVKQRIRGLSINASRVVVPLNGSVSFS
TTLDAGSDVHYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVSTAQDSVFIYVL
QFIEGLQVAGGGSGCCFPTNHTLQLQALVRDGTNISYSWTIQRDGSPALVGSGKSFLLTV
LEASTYHIQLRATNMLGSVSANRTIDFVEPVEFLTVAASPNPAAVNRRITFVAELAGGSD
VIYTWTLEEGLSLETSEPSTIHSFSTAGLYPVRVSARNQLGSVNVTIEVTVQVPVSGLSI
RVSEPDSSFVAAGATVPFSGLLATGTNVSWCWAVPGGSKHGQHIAVGFPDAGVFSIQLNA
SNAVSWITALHNLTVEEPIRGLVLWASSKVVAPGQLVYFQILLAAGSAVTFHLQVGGANP
EILFRPHFSHSFSRVGDHVVSVQAENHVSRGQAQVRVLVLEAVDGLQVPNCCELGMVTGT
EKNFTARVQRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIHVRAFNELGG
VNLTLTVEVQDAIQYVVLRSGRCFANRSARFEATTSPSPRRVAYHWDFGDGAPMQDTEEP
WADHSYLLPGDYRVEVNASNLVSFFVAQATVTVQVLACREPEVDVALPLQVLMRRSQRNY
LEAHVDLRDCVTYQTEYRWEVYRTASCQRPGPMARVALPGVDVSRPQLVVPRLALPVGHY
CFVFVVSFGDTPLARSIQANVTVAAERLVPIIEGGSYRVWSDTQDLVLDGSKSYDPNLED
DDQTPLSFHWACVAATQSETNACVLNFGPRGSSVVTIPRERLEAGIEYTFNLTVWKAGRK
EEAASQTVLVRSGQVPIVSLECVSCKAQAVYEVSRSSYIYLEGHCHNCSSGSKHGRWAAR
TFSNKTLVLDETTTSTGSSGMRLVVRRGVLRDGEGYIFTLTVLGHSGEEEGCASIRLSPN
RPPLGGACRLFPLDAVCALTTKVHFECVGWQDAEDASAPLVYALLLRRCRQGHCEEFCIY
KGSLSTYGAVLPPGFQPGFEVGLAVVVQDQLGAAVVALNRSLAIVLPEPNSSMGLIPWLY
SLTASVLPGLVRQADPQHVIEYSLALITVLNEYEQAPDVATEPNSEQQLRAQMRKNITEI
LVSLRVNTVDDIQQITAALAQCMVSSRELVCRSCLKQTLHKLEGMMRILQAETTQGTVTP
TTIADSILNITGDLIHLASSDIQSPQPSELGTESPSLMVASKAYNLSSALMCILMRSRVL
NEEPLTLAGEEIVAQGKRSDPRNLLCYGNASSSGCHFSIPEAFSGALSNISDVVQLIFLV
DSNPFPFGYINNYTVSTKVASMAFQTQAGTQIPIERLAKERAITVKVPNNSDQATQSLHT
PVGSAVIQPQASVSAVVTPDNSNPAAGLHLQLTYTVQSEHYLSEEPEPYLAVYLHSTPQP
NEYNCSASRKISLEMLTGTDHRPYTFFIAPGTGYPGGSYHLNLTSHFHWSALEVSVGLYT
SLCQYFSEEEMMWRTEGLVPLEDTSPSQAVCLTRHLTAFGASLFVPPSHIHFIFPEPASR
VNYIVLLTCAMCLITYTIMVVILRRLDQLDVSWARVIPFCGKGGRFKYEILVKTGWGRGS
GTTAHVGIMLYGADSRSGHRHLDGDRAFHRNSLDIFRIATPHSLGNVWKIRVWHDNKGLS
PAWFLQHIIVRDLQNAHSTFFLVNDWLSVETEANGGLVEKEVLAASDEALWQFQRLLVAE
LQRGFFDKHIWLSIWDRPARSRFTRVQRATCCVLLICLFLGANAVWYGVVGDATYSVRPL
SSLIPPSVDTVAIGLVSSVVVYPVYLAILFLFRMSRSKVAGGPSPSPTVQQTLELDSCVD
SSMLGSSFLTFSGLRAEAFTGQVKNDLLMDDSKSLACWPSSEGTLSWPDLLSDPSIVGST
LQRLARGQTGRGLGPEEDSLSLVSPSSPAKYFSASDEDLIQQVLAEGTSGLVVTQDTLVE
TDLLTGLSSVAGEKMEAPAIQRFGGSGPPGSGLTWEQPPLARLSRTGLVEGLQKRLMPAW
CAPLAHGLSLLLVAVAVGVSGWVGASFPPSVSVMWLLSSSSSFLASFLGWEPLKVLLEAL
YFSLVAKRLYPDEDDMLVESPAVTPVSERVPRVRPPHGFALFLAKEEARKVKRLHSMLRS
LLVHMLFLLVTLLANYGDASCHNHAYHLQSAIKQELDSQAFLAITRSDEFWPWMSHVLLP
YIHGNQSSPELGPPRLRQVRLQEALCPDPPSPGTHLCPAAAGFSTTDYGVGWQSVAHNGS
ETWTYTVPDLLGTWYWGYCAVYDSGGYVQELGLSLEESRTRLSFLQQHNWLDSRSRAVFV
ELTRYSPAVGLHAAITLRLEFPAAGRALAALSVHPFALLRFSTGLSLPLLTSVCLLLFAV
YFSVAEARAWRREGCSHAMQPGAWAQWLLVTLTAAAALVRLAQLGTADRQWTRFLRGRPH
HFTSFDQVAQLSTAARGLAASLLFLLLVKTAQQLRFVRQWSVFGKTLCRALPELLGATLG
LVILGVAYAQLAILLVSSCTDSLHNMVQALLVLCPSTRVPTLCPGESWNLSLLLCMGLWA
LRLCGALRLGAVLLRWRYHSLRGELYRPAWEPQDYEMVELFLRRLRLWMGFSKVKEFRHK
VRFEGMEPLPSRSSRGSKSSPEAPPPSGGSDSSHPSTSSSQLDAPNGEPEPEPSRLHAVF
EALLTQFDRLNQATEDVYQLEQKLQRLQGCGSTQFSRSPHGSPFQSPKSALPSHLVQASE
GMDPGIGHSRTSLWTKNRVCQHST
Download sequence
Identical sequences 10141.ENSCPOP00000002924 ENSCPOP00000002924 ENSCPOP00000002924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]