SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002996 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002996
Domain Number 1 Region: 409-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 192-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 604-784
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.96e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 7-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-34
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 817-998
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.00000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002996   Gene: ENSCPOG00000003316   Transcript: ENSCPOT00000003359
Sequence length 1202
Comment pep:novel scaffold:cavPor3:scaffold_18:33485098:34134505:-1 gene:ENSCPOG00000003316 transcript:ENSCPOT00000003359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLAL
KNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGIL
TTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRL
AKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNG
LILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEW
YHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTAL
LNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGW
NRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGIL
MATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVV
RRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFN
GMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKT
TSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISR
DTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLAS
VDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFT
EPRAEIPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLG
DYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIE
RYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVR
LVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGRPPTKEPVSQTTDDILVAS
AECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCI
LILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEY
YV
Download sequence
Identical sequences ENSCPOP00000002996 10141.ENSCPOP00000002996 ENSCPOP00000002996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]