SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003141 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003141
Domain Number 1 Region: 172-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.05e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 492-631
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.59e-26
Family Ricin B-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003141   Gene: ENSCPOG00000003476   Transcript: ENSCPOT00000003520
Sequence length 640
Comment pep:known scaffold:cavPor3:scaffold_0:80692973:80735633:-1 gene:ENSCPOG00000003476 transcript:ENSCPOT00000003520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKKRYRHGPCRHQFLLLLLMLGCLLMVVTVLYPPLPTLHQAVTTQASKHSSEAGYHLD
LGESQEWVLGNEEEVEEYGLLEDLPSFISLQEDQLLMAVASPRARRNQSQGRRGGSYRFI
KHLRRQNEEAPDRDWGTKEEDGEVSEEEELGPLNLDSQGLNEVLSAHLPLQRVLPEVRHP
LCLQQQLGDSLPTASIILCFHDEAWSTLLRTVHSILNTAPTAFLKEIVLVDDLSKQGQLK
SALSEYVAQLEGVKLLRSTKRLGAIRARMLGATRATGDVLVFMDTHCECHPGWLEPLLSR
IAGDRSRVVSPVIDIIDWKTFQYYPSKGLQHGVLDWKLDFFWEPLPEHERIALPSPISPI
RSPVVPGEVVALDRRYFQNIGAYDPLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHVY
RNQEARSPLEQEAILRNKVLIAETWLGSFKEVFYRHNPEAFTLNKAEKPDCTERLQLQSR
LGCRTFHWFLANIYPRMYPSEHRPKFSGKLHNSGLGLCADCQAERGFLGCPMTLAPCNDS
RKQQHLEHTGRKEIHFGSPQHLCLDIKKEQVVLQNCTEEGPAIHQQHWDFQENGMIVHII
SGKCMEAMVQQNNKELFLSQCDGKASQLWQFDEVHPVDKR
Download sequence
Identical sequences H0V0Y8
XP_003480227.1.53824 ENSCPOP00000003141 10141.ENSCPOP00000003141 ENSCPOP00000003141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]