SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003251 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003251
Domain Number 1 Region: 589-887
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-83
Family Protein kinases, catalytic subunit 0.000000000718
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-73
Family Ephrin receptor ligand binding domain 0.000000931
Further Details:      
 
Domain Number 3 Region: 301-505
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-39
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 4 Region: 883-949
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-21
Family SAM (sterile alpha motif) domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003251
Domain Number - Region: 228-293,339-354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00651
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003251   Gene: ENSCPOG00000003600   Transcript: ENSCPOT00000003644
Sequence length 950
Comment pep:novel scaffold:cavPor3:scaffold_49:6779180:6929046:-1 gene:ENSCPOG00000003600 transcript:ENSCPOT00000003644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISK
GNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAAD
ESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENL
AIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQK
GDTCEHTACGRGFYKSSSQDLQCSRCPTHSFSDREGSSRCECADGYYRAPSDPPYVACTR
PPSAPQNLIFNINQTTVSLEWSPPADNGGRHDVTYRILCKRCSWEQGECVPCGSNIGYMP
QQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVM
KERVLQRSVELSWQEPEHPNGVITEYEIKYYEKNDISKSYNISRNCRPQFSNLKSGTVYV
FQIRAFTAAGYGNYSPRLDVATLEEAAATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFI
IGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIER
VIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHL
EGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHR
DLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSAS
DVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKER
AERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNAPDFTTFCSVGEWLQAIKM
ERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQ
Download sequence
Identical sequences ENSCPOP00000003251 10141.ENSCPOP00000003251 ENSCPOP00000003251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]