SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003285 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003285
Domain Number 1 Region: 224-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-32
Family Leech intramolecular trans-sialidase, N-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 671-747,780-800
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000165
Family Zinc protease 0.085
Further Details:      
 
Domain Number 3 Region: 1508-1582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1574-1631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000695
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Domain Number 5 Region: 1027-1089
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000153
Family Fibronectin type III 0.0088
Further Details:      
 
Domain Number 6 Region: 1451-1514
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000222
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number 7 Region: 523-613,703-746
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000355
Family Matrix metalloproteases, catalytic domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003285
Domain Number - Region: 1387-1449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0504
Family Complement control module/SCR domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003285   Gene: ENSCPOG00000003637   Transcript: ENSCPOT00000003681
Sequence length 1775
Comment pep:known scaffold:cavPor3:scaffold_12:7566461:7813501:-1 gene:ENSCPOG00000003637 transcript:ENSCPOT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCLKILRLGLVVLAGWAFDSTSSELGWTGKKPMAQRGRLKHVLLEGEHCWLGAKVQKPR
AAPQHHLFGVYPSSPGNYLRPFPVGEQGTHHTGHRKPDAAGRAASRVSPDLTGSTELRRE
VEQPAAPWVGDGPIGQSKLLEDDDTYLGNQGSKEPLGKAALRESSARFPMLQRTESSYSE
EGWAKARHPRQSGKEASRRPFQPWHEDQLTHRAQSSPLEDSIQNGGGSLDWETETFNPQG
GLPVLYFSGRRERLLLRPELLAEIPREAFTVEAWVRPEGGQHNPAIITGVFDNCSHTVND
KGWALGIHSGKDKGRQDARFFFSLRTDRMKKATTVTGHSRYQPGTWTHVAATYDGQRMAL
YVDGTQVANSPGQSGPLNSPFMASCRSLLLGGDSSENGHYFRGHLGTLVIWSTALSQSHL
QHSPQHESGPEELAILVLTANFDPLKEQWTPFRDENYPRLEVLQGSGPQPEILSPLQPPL
CGQTVCDNVELISQYNGHWPLRGEKVIRYQVVNVCDDQGLHPMVSEAQIQQQHEALNEAF
SRYNISWQLSVHRVLNSTLRHRVVLVNCEPSKVGNDHCDPECEHPLTGYDGGDCRLQGRC
YSWNRRDGICHAACNNMLNDFDEGDCCDPEVTDVRKTCFDPDSPKRAYMSVKELKEALQL
NGTHFLNVYFASSVRENLAGAATWPWEKEAVTHLGGVVLNPAFYGMPGHTNIMIHEVGHV
LGLYHVFKGVSERDSCDDPCREMVPSMETGDLCADTAPTPKSKLCQPPEPANDTCGITHF
PGAPFNNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWSQTRKPTPIPIPPMVIGQTPK
SLTIYWLPPISGVVYDRASGSMCGSCSEDGTFRQYVHTASSRRVCDSSGYWTPEEAVGPP
DVNQPCEPSLQAWSPELHLYHMNMTVPCPPEGCSLELLFQYPVPADTLTLWVTYLSMDSS
QALFDTEILLENQKSVHLGPLDTFCDTPLTIKLHVDGRVSGVKVYTFDERMEIDAALLTS
QPHSPLCSGCKPVKYQVIREPPFASGSPMVVTHPHRKFTDTEVTPGQMYQYQVQAKAGAE
LGEPSPPLYHIHGAPYCGDGKVQKSSGEECDDGDLLDADGCSRACKLEEGFNCVGEPSLC
YRYEGDGICEPFEKKTSIIDCGLHTPKGSLDQWASQAFSSHEDRKKCPVSLVTGEPHSLI
CTSYHPDLPKHRPFTGWFPCVTSGKRPQEEGSEQSEGSLEKENEVWLKVCFKRPGVATAV
FIFLTSDGLVAGKHQRPTLTVYLTDVSGSNHSLGTYELSCQHNPLVINVIPDANVLAHRT
TSVLLNFSSHLVGISAVALRTSSHISLSAPNSCIPEPEGPKHQGQSCVHQPCGKLVSCVP
LLLAHTDMVNCTSSSPGNMKCAITCQRGFALQTRNGQYLRPIQKEILLTCSAGVWDRDVS
CMPLDCGIPDPSLVNYADFSCSDGTDFLKRCSISCVPPAKLQESGLSPWLTCLEDGIWSL
PEVYCKVECDAPPVIPNANLLLPRCMRGGHDVGTVCRYECKPGYYVVEGTERKFRNKFLK
LQCLEDGIWEQGSCMPVVCEPPSPVFEGMYECTNGFNLDSQCVLKCNQESERLPIVCTKE
GLWTPEFKLCENLRGECPPPPSELNFLEYKCEQGYGIGAMCSLSCIIPPNDPVMLPENIT
ADKLEYWMEPVKVQSIVCTGRRRWHPDPLLIHCIQSCEPFQADGWCDTINNRAYCNYDGG
DCCSSTLSSKKVTPFAADCDQDECTCRDPKAEENQ
Download sequence
Identical sequences 10141.ENSCPOP00000003285 ENSCPOP00000003285 ENSCPOP00000003285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]