SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003364 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000003364
Domain Number - Region: 244-331
Classification Level Classification E-value
Superfamily DEATH domain 0.00141
Family DEATH domain, DD 0.015
Further Details:      
 
Domain Number - Region: 30-96
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.068
Family Growth factor receptor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003364   Gene: ENSCPOG00000003725   Transcript: ENSCPOT00000003769
Sequence length 334
Comment pep:novel scaffold:cavPor3:scaffold_52:10097052:10098781:-1 gene:ENSCPOG00000003725 transcript:ENSCPOT00000003769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRHLLQTSVLFLALAVPSEASQYCGRLEYWNPYNKRCSSCQQRFGSPPYPDYEFVENC
GHNDFGDVLKNPFKKCSPGQCNRDFAELCTPCNGGALATAPTGSHGGTRHRNREVLVLTL
EGWAGARRRWEPTSPGSSSVSWTTQSNVSPLHFVLPLVLVLPLVLVLLLICFLLLQRHHQ
HKEKVLSPLCPGVFPRDPSNYTLCLHLASSGSLEAGHTGKIPLPSKELAGLATQPLSRLL
DELEVLEELIVLLDPEPGPGGSTACGTTRHLAARYGLPAAWSTFAYSLRPSRSPLWALIE
MVVAREPSATLGQFSEHLVQLGRADALLVLSRLG
Download sequence
Identical sequences ENSCPOP00000003364 10141.ENSCPOP00000003364 ENSCPOP00000003364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]