SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003570 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003570
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-16
Family Growth factor receptor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003570
Domain Number - Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003570   Gene: ENSCPOG00000003953   Transcript: ENSCPOT00000003997
Sequence length 265
Comment pep:known scaffold:cavPor3:scaffold_25:124045:138977:1 gene:ENSCPOG00000003953 transcript:ENSCPOT00000003997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLYVVALVLSCQHLTASSRGLKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEGRYL
HKGRCYPACPEGSTPTNGTMECSSPAQCEMSEWSLWGPCSKKKKLCGFRKGSEERTRRVL
HAPWGDHTTCSDTKETRKCTVRRTPCPDGQKRRKGGQGRRDNTNRNSGRKENKEASPSSR
RPKGQQQLPRQPQPGTAGPLTSAGP
Download sequence
Identical sequences ENSCPOP00000003570 ENSCPOP00000003570 10141.ENSCPOP00000003570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]