SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003589 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003589
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-24
Family C-type lectin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003589   Gene: ENSCPOG00000003976   Transcript: ENSCPOT00000004020
Sequence length 213
Comment pep:novel scaffold:cavPor3:scaffold_3:28844735:28859354:1 gene:ENSCPOG00000003976 transcript:ENSCPOT00000004020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDCPSSTWVQFQDSCYIFLQEAIKVEGIEDVRNQCTGHGADMISIHNKEENAFILDTLKK
QWKAPDDILLGMFYDTDEASFKWFDNSNMTFHNWADQDDDDDLVDTCGFLHTKTGEWKKG
NCEVSTVEGTLCKAAIPYDKKYLSDNHILIATLVVASTVILTVLGAIIWFSYKRHSDSGF
TTIFSTVSQSSFNDDCVLVGGEENELAVLNQFS
Download sequence
Identical sequences 10141.ENSCPOP00000003589 ENSCPOP00000003589 ENSCPOP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]