SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003877 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003877
Domain Number 1 Region: 950-1019
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.2e-18
Family TB module/8-cys domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1851-1989
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 2057-2126
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 4 Region: 2336-2408
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-17
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 5 Region: 449-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.16e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 1530-1603
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-17
Family TB module/8-cys domain 0.0000131
Further Details:      
 
Domain Number 7 Region: 1319-1455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 653-726
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.0009
Further Details:      
 
Domain Number 9 Region: 717-848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 2449-2576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 12 Region: 1028-1156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 1197-1324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 14 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.93e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 15 Region: 1689-1755
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 16 Region: 845-931
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000131
Family TB module/8-cys domain 0.0024
Further Details:      
 
Domain Number 17 Region: 2576-2692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000259
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 2208-2264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000594
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 19 Region: 576-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000761
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 1609-1658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 21 Region: 1156-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000227
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 22 Region: 2012-2060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 23 Region: 1770-1819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000398
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 24 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 1444-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 26 Region: 2289-2337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000545
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 27 Region: 1486-1533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000074
Family EGF-type module 0.0002
Further Details:      
 
Domain Number 28 Region: 2411-2455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 29 Region: 1813-1849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 30 Region: 2127-2167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.00054
Further Details:      
 
Domain Number 31 Region: 2171-2219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000432
Family EGF-type module 0.00044
Further Details:      
 
Domain Number 32 Region: 1978-2015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000222
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 33 Region: 1651-1694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003877
Domain Number - Region: 150-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003877   Gene: ENSCPOG00000004298   Transcript: ENSCPOT00000004343
Sequence length 2876
Comment pep:known scaffold:cavPor3:scaffold_23:26980985:27187576:-1 gene:ENSCPOG00000004298 transcript:ENSCPOT00000004343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGGLLEVALGFSVLLASYTSHGADANSEAGNAKEIRASRAKRRGGGGHDTLKGPNVCG
SHFNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSEDHCICQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCC
DVGRCWSPGATVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPLPPVQPGVPGFS
PGPAIPVPRPPVEYPYPSREPSMVVPFNITTDYCQLVRYLCQNGRCIPTPGSYRCECNKG
FQLDLRGECIDVDECEKNPCTGGECVNTPGSYTCHCRAGYQSTLTRTECRDIDECLQNGR
ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSVRNMCLNGMCINEDGSFKCICK
PGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRS
TCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTS
AGTDINECALDPDICPNGICENLRGSYKCICNSGYEVDITGKNCVDINECVLNSLLCDNG
QCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCRNSPGSFICECSPESTLD
PTKTICIETIKGTCWQIAIDGRCEININGATLKSQCCSSLGAAWGSPCTVCQVDPICGKG
YSRIKGTQCEVLDIDECEVFPGVCKNGQCVNTRGSFKCQCPNGMTLDATGRICLDIRLET
CFLRYEDEECVLPIAGRHRMDACCCSVGAAWGTDECEECPMRNTPEYEELCPRGPGFATK
DITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS
PDLCGRGQCVNTPGDFECKCEEGYESGFMMMKNCMDIDECQRDPLLCRGGTCFNTDGSYR
CECPPGHQLSPNISACIDINECELSANLCPNGRCVNLMGKYQCACNPGYHSTPDRLFCVD
IDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNI
PGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGK
TGCTDINECEIGAHNCGRHAVCTNTAGSFRCSCSPGWIGDGIKCTDLDECSNGTHLCSQH
ADCKNTLGSYRCLCKEGYTGDGFTCTAADLDECSENLNLCGNGQCLNAPGGYRCECDMGF
VPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECDIGYELDRSGGNCTDVNECLDPT
TCISGNCVNSPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGV
GVSKASCCCSLGRAWGTPCEVCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPG
LCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICP
PDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQ
CPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPV
GFFYNDKLLVCEDIDECQNGPLCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQE
IPNICSHGQCIDTVGSFYCLCHTGFKTNPDQTMCLDINECERDACGNGTCRNTIGSFNCR
CNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDIN
ECLLDPKKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGS
FRCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDP
CELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPF
GYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPL
LCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYMCI
CGPGYQRRPDGEGCVDENECQTRPGICENGRCLNTRGSYTCECNDGFTASPAQDECLDSR
EGYCFTEVLQNLCQIGSSNRNPVTKSECCCDGGRGWGPFCEICPFQGTVAFKKLCPHGRG
FMTNGADIDECKVIHDVCRNGECVNDRGSYHCNCKAGYTPDITGTACVDLNECDQAPKPC
NFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGF
TQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNH
RCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPA
GFQYEQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMSRG
GPDPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETETAEVEDQSGTEANVSLAS
WDEEKMATFDFNISHISNKVRILELLPALTTLTNHNRYLIESGNEEGFFKINKKEGISYL
HFTKKKPVAGTYSLQISSTPLYRKKELNQLEDNFDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences 10141.ENSCPOP00000003877 ENSCPOP00000003877 ENSCPOP00000003877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]