SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003900 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003900
Domain Number 1 Region: 102-422
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.06e-60
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000424
Further Details:      
 
Domain Number 2 Region: 417-552
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.3e-23
Family Ricin B-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003900   Gene: ENSCPOG00000004324   Transcript: ENSCPOT00000004370
Sequence length 556
Comment pep:known scaffold:cavPor3:scaffold_20:13856406:13932025:1 gene:ENSCPOG00000004324 transcript:ENSCPOT00000004370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIRANAIAILTVAWILGTFYYLWQDNRAHAAFSGGRSTKRAGGRPEQLREDRTIPLIV
TGTPSKGFDEKAYLSAKQLKPGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSLSYSS
DLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKV
KCLRNDRREGLIRSRVRGADVAAAAILTFLDSHCEVNVEWLQPMLQRVKEDHTRVVSPII
DVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTRPIRTPVIAGGIFVID
KAWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGNA
LTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMDCKSFRWYLENVY
PELTVPVKEVLPGIIKQGLNCLETQGQDTAGDFLLGMGICRGSAKNPPPAQAWLFTDHLI
QQQGRCLAATSVSPPGSPVILQVCNSKESKQKWKRKGSFIQHSISGLCLETKPAQLVTSK
CQADAQAQQWQLLPHT
Download sequence
Identical sequences H0V2W6
10141.ENSCPOP00000003900 ENSCPOP00000003900 ENSCPOP00000003900 XP_003472426.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]