SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003924 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003924
Domain Number 1 Region: 81-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-55
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 34-90
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000828
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003924   Gene: ENSCPOG00000004351   Transcript: ENSCPOT00000004397
Sequence length 288
Comment pep:known scaffold:cavPor3:scaffold_7:59798288:59811567:-1 gene:ENSCPOG00000004351 transcript:ENSCPOT00000004397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAPGRLPSVRRGAWQTPRGRGGSGGALAAGSESLGPAGRLPSRVLELVFSYLELSELRS
CALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCDLPSYKAKVRAFQHAFSTND
CSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRA
PMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMED
KTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences ENSCPOP00000003924 ENSCPOP00000003924 10141.ENSCPOP00000003924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]