SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003935 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003935
Domain Number 1 Region: 40-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.18e-28
Family Laminin G-like module 0.064
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003935
Domain Number - Region: 386-588
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000218
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003935   Gene: ENSCPOG00000004362   Transcript: ENSCPOT00000004409
Sequence length 643
Comment pep:known scaffold:cavPor3:scaffold_90:504169:548558:1 gene:ENSCPOG00000004362 transcript:ENSCPOT00000004409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDLHPLDILAEVIPVNGAVDRIKMAQAQGVWGLQLSDAPPRTVSFPASRIFSRCDLFPEE
FSIVMTLKVPSLPPKRNQYLLTVVAEDRDALLLGLRYSPNRLHFLFLHEDTAGAWQTRVS
FRSSSLMDSQWHTLVLAVSEGSFSLTTDCGLPVDIMADVPFPATLSVRGARFFIGSRRRA
KGSFTGLVRQLALLPGSDATLRLCPSRRAHLAELSIPQVLQGLEGKLDDNEVLKYPHEAR
LKVTLGSRPSCTKAEDAQFWFDVSQRGLYLCVGSEWVSVLAAKVKLDYVEEHQSLFTNSE
TLGLEVFGIPQVGLFLATANRKATSAIYKWTDGKFVSYQNIATHQAQSWRHFTIGKKIFL
AVANFGPNEEGQEFSVIYKWSHRRLKFTPYQRIATHSARDWEAFKVDGEHFLAVANHREG
DNHNIDSIIYKWNPSTQRFEPHQSIATSGAYDWEFFTVGPYSFLAVANTFNGTSTRVHSH
LYIWLVGAFRLFQSFLTFGAADWEVFRIGDRVFLAVANSHSYDVEMQLQNDSYVINSVIY
ELNVTAQTFVKFQDIPTCSALDWEFFSVGEDYFLVVANSFDGNTFSVNSIIYRWQGYEGF
VATHRLPTFGCRDWEAFSTAAGSYLIYSSAKEPISRVLLLRTG
Download sequence
Identical sequences ENSCPOP00000003935 ENSCPOP00000003935 10141.ENSCPOP00000003935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]