SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004297 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004297
Domain Number 1 Region: 51-380
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.41e-40
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 386-521
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.92e-18
Family Ricin B-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004297   Gene: ENSCPOG00000004774   Transcript: ENSCPOT00000004825
Sequence length 529
Comment pep:novel scaffold:cavPor3:scaffold_107:2787172:2819519:1 gene:ENSCPOG00000004774 transcript:ENSCPOT00000004825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKPQAPKKLFPDSALFQRWGEDLPEAEQRKAQDLFHRFGYNVYLSNQLPLDRSLPDTRDS
RCLQKTYPSQLPSLSVILIFMDEALSVIQRAITSIINRTPLWLLKEIILVDDFSSNGELK
IPLNEKIEFYNQMYPGLLKIIRHAERKGLAHARNTGWKAASADVVVILDAHVEVNVGWAE
PILARIQEDRTVIISPVFDNVRFDTFQLLKYEVAVDGFNWQLWCRYDFVPQTWIDLGDVT
APVRSPSIMGILAANRLFLGEIGALDDGMLVYGGENVELSLRSWHLGKPGGRYTLPVLTL
AKMSCALSPVSLTMTSHQNANNIQLAGCWKTLDNPQFPHLWSTPSVENSGIDYGDISSKR
MLQEKLKCKSFDWYLKNVYPVLKPIPIHDIVGYGRMKNSLDKGICLDRGPVTNNIPIMYA
CHELGSQYVYYRLTGEFYVGSLVAEVHSDDLCLTDPGHREEPTLEQCSKAAQNKLHIYWD
FKQGGAMVNRDTHRCLEIRREPSGTYVPVLQTCTAQVWEIQYTLGNLSQ
Download sequence
Identical sequences ENSCPOP00000004297 ENSCPOP00000004297 10141.ENSCPOP00000004297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]