SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004344 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004344
Domain Number 1 Region: 71-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000518
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000122
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 135-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000345
Family VWC domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004344   Gene: ENSCPOG00000004828   Transcript: ENSCPOT00000004879
Sequence length 375
Comment pep:known scaffold:cavPor3:scaffold_58:7569036:7584405:-1 gene:ENSCPOG00000004828 transcript:ENSCPOT00000004879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPTSLLHSGPGFRLPGDMRGFLLSTLLCAELAQQMKFCCRAQDPGQVDGTPAGGPGGAT
EVLQRKQFCHWPCSCPHQKPSCPPGVSLVRDGCGCCKICAKQSGDICNEAELCDPHKGLY
CDYSADRPRYETGVCAYLVAVGCEFNRVHYHNGQVFQPHPLFSCLCVSGVIGCTPLFRPR
PAASHCSGSQAGKKSDQSHCGLTQSQQQISTSYRTMPAYRNLPLIWKRKCLVQATKWTPC
SKTCGMGISNRVTNENSNCEMRKEKRLCYIQPCNSTMAKALKIPKGKTCQPTFQQSKAEK
FAFSGCSSTQSYKPTFCGVCTDKRCCIPNKSKMITVQFDCPNEGSFKWKMQWITSCVCQR
NCREPGDIFSEFKIL
Download sequence
Identical sequences 10141.ENSCPOP00000004344 ENSCPOP00000004344 ENSCPOP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]