SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004570 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004570
Domain Number 1 Region: 617-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000369
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004570
Domain Number - Region: 440-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 699-838
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000122
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number - Region: 476-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000129
Family EGF-type module 0.0097
Further Details:      
 
Domain Number - Region: 547-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0029
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 354-438
Classification Level Classification E-value
Superfamily Cadherin-like 0.00549
Family Cadherin 0.054
Further Details:      
 
Domain Number - Region: 649-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00939
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004570   Gene: ENSCPOG00000005082   Transcript: ENSCPOT00000005137
Sequence length 847
Comment pep:known scaffold:cavPor3:scaffold_11:34154714:34205188:-1 gene:ENSCPOG00000005082 transcript:ENSCPOT00000005137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRWHGQKRWKRQNFNAFPALSALQSSSQINLEELTYFFPEDHIEKVHQEFVPSWPTPSGL
TEDSTLALCEQTLAHSSLGKLCLAFLGRRLKDVIDMCIKDVLLKDDVSWAEAGLALIENE
CERRVLEEGKHSTEKYGKSMEDILLVLKCPHLCSGHGECMEWGCVCAPGFSSYDCSALYD
KPEIIELENAGFCDVQKYNCVMVKVFGQGFKELPSIICEVTKLKYNGSKWVLGEPVYAQA
VFHNNRTVDCLLPASAQQSDTLDPMGEKPLAKWQLKISNDGYTFSNTKIMVVYDGACQVC
GLYENDTCTIKENGCIINGLCYTEGDKNLTSPCLICRPEISQFTWSYLENNQSPVMQASQ
EKLQAFYGENFEYQFMALDPENSEVQFTLELGPEGAHISPAGLLTWKAESQAAQRFTLHL
SDDCDAETRVTVEVTVKSCDCLNGGSCVPDRKFPVGSGAYLCICLPGFHGGLCEVAVDAC
QPNPCGLGRCTRVLGSYSCDCPPELKVETQILNEFTTQAVVIRGSDKNVIKEEGTKQGEN
HVKPTKQKCATICKRPCGKNRACVAPNTCKCKPGYTGSNCQTAICEPACRNLGKCVKPNV
CECLPGHGGTTCDKELCSPPCQHGGTCLPGNLCTCAYGFVGPRCETMVCNRHCENGGECF
APDVCQCKPGWDGPTCNTAVCDPICLNGGSCYKPNTCLCPNGFFGAQCQNAICHPPCKNG
GHCMRNNVCICREGYTGRRCQKSICDPMCMNGGKCVGSNVCSCPSGWSGRWCSTPVCIQQ
CRHGGECVAPGVCHCPPAWEGARCQIPVCDQQCLHGGRCAFPNVCFCRPGYSGIKCEKKI
QQEIKRN
Download sequence
Identical sequences ENSCPOP00000004570 ENSCPOP00000004570 10141.ENSCPOP00000004570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]