SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004884 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004884
Domain Number 1 Region: 43-187
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-31
Family C-type lectin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004884   Gene: ENSCPOG00000005427   Transcript: ENSCPOT00000005485
Sequence length 274
Comment pep:known scaffold:cavPor3:scaffold_34:4987793:5009091:-1 gene:ENSCPOG00000005427 transcript:ENSCPOT00000005485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAVSLLLGAALLCGPGAFCRRVVSGQKVCFADAKRPCYKMAYFHELSSRVSFQEARQA
CESEEGVLLSLENEAEQKLIESMLKNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQ
WSDGSSSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKY
EPEISPTEPVEKPYLTNQPGNTRGDVAVTDGVGIIPNLIYVIIPTIPLLLLILVAFGTCC
FQMLHRSKGRTKTSPNQSTLWISKSTRKESGMEV
Download sequence
Identical sequences ENSCPOP00000004884 ENSCPOP00000004884 10141.ENSCPOP00000004884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]