SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005059 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005059
Domain Number 1 Region: 151-235
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.49e-25
Family Thyroglobulin type-1 domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 65-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000604
Family Growth factor receptor domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005059   Gene: ENSCPOG00000005613   Transcript: ENSCPOT00000005674
Sequence length 240
Comment pep:known scaffold:cavPor3:scaffold_9:46704439:46708347:-1 gene:ENSCPOG00000005613 transcript:ENSCPOT00000005674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHDGLLPPLLLVTLLLAACPGGALARCPGCGQGVQAGCQEGCVEEEDGAPPPAESCAEA
KGCERREGQQCGVYTPFCAPGLQCRPPEGQEEPLRALLMGRGRCRPARAPTAIEETLKEN
KPHGSATRPQDVNRRDQRKNPGTSTTPSKPNSGAVQDTEMGPCRKHLDSVLQQLQTEIFR
GSQTLYVPNCDHRGFYRKRQCRSSQRQRRGPCWCVDRMGQPLPGSAEGDRSSHCPAGSSG
Download sequence
Identical sequences ENSCPOP00000005059 10141.ENSCPOP00000005059 ENSCPOP00000005059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]