SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005160 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005160
Domain Number 1 Region: 60-392
Classification Level Classification E-value
Superfamily Subtilisin-like 5.37e-94
Family Subtilases 0.000000000903
Further Details:      
 
Domain Number 2 Region: 389-539
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-41
Family Proprotein convertase P-domain 0.00014
Further Details:      
 
Domain Number 3 Region: 582-746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-35
Family Growth factor receptor domain 0.00025
Further Details:      
 
Domain Number 4 Region: 721-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000782
Family Prohormone convertase 1 pro-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005160   Gene: ENSCPOG00000005722   Transcript: ENSCPOT00000005784
Sequence length 858
Comment pep:known scaffold:cavPor3:scaffold_10:47240204:47374035:-1 gene:ENSCPOG00000005722 transcript:ENSCPOT00000005784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIGNLEDFYHFHHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQKVKRRVKRQVRSDPQTF
YFNDPIWSNMWYMHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPN
YDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRM
LDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEFGIKKGRQGLG
SIFVWASGNGGREGDYCSCDGYTNSIYTISVSSTTENGYKPWYLEECASTLATTYSSGAF
YERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHL
KANDWKVNGAGYKVSHLYGFGLVDAEAIVLEAKKWTAVPSQHMCIATSDKRPRSIPIVQV
LRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDF
SNEGFTNWEFMTVHCWGEKAEGEWTLEIQDLPSQVRNPEKQGKLKEWTLILYGTAEHPYH
TFSSHQSRSRMLELSVPESEPPKAAGSPAQAEIPEDEEDYTGVCHPECGDKGCDGPNADQ
CLNCVHFSLGSSKTGRKCVSECPLGYFRDKAARRCRRCHKGCETCSSRSPTQCLSCRRGF
YHHQEMSTCVTQCPAGFYADESQKHCLKCHPSCKECMDEPEKCTMCKEGFSLARGSCIPD
CEPGTYFDSELIQCMECHSTCRTCVGPSREECIHCAKNFSFQDWKCVPACSEGYYPEEMP
GFPHKVCRRCEDNCLSCEGSSRNCSKCKAGFMQLGTSCISNLTCSNADETFCEMVKSNRL
CERKLFIQFCCRTCLLAG
Download sequence
Identical sequences ENSCPOP00000005160 ENSCPOP00000005160 10141.ENSCPOP00000005160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]