SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005446 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005446
Domain Number 1 Region: 144-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 2 Region: 204-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 3 Region: 91-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000267
Family EGF-type module 0.006
Further Details:      
 
Domain Number 4 Region: 6-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000439
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005446
Domain Number - Region: 474-551
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0726
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005446   Gene: ENSCPOG00000006033   Transcript: ENSCPOT00000006097
Sequence length 715
Comment pep:known scaffold:cavPor3:scaffold_93:4130420:4254664:-1 gene:ENSCPOG00000006033 transcript:ENSCPOT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVCATCHEHATCQQRDGRKICMCNYGFVGNGRTQCIATDKNECQFGAAVVCGNHTSCHN
TLGGFYCVCLEGYRATNNNKTFIPNDGTFCTDVDECEVSGLCRPGGRCVNTHGSFECYCM
DGYLPRGGPEPFHPSRDATVCTEIDCGPPPEVPGGYIVGNYSSRLGSQVRYSCKEGFFRV
PEDTVSSCTPLGTWAPPGLYCQEITCGRPPEVQNAILLGNHSSRLGSVAHYVCQEGFESP
GGKITSVCTEKGTWRESTLTCREIMTAINNVSVFNNTCLRWQISSGGINSKIIFMINIKG
QRSDPVESVHEETVNLTTDSRTPEVCLTLYQGTSYTVNISTAPPRRSVPTVLAFQTAEDD
LLENDGLFNISIFNETCLKLKRHSRKVGSEQIYQFKVLGQKWYLDNFYHATSFNFTTSEQ
AAQVCLDLYPATDYTVNVTLLGPPEPHSVQITMMTAPAVKQTIRNISVFNETCLRWRSMK
TAGTEEMYLFHIWGQRWYQKGYTQEMIFNTTTSSQSPEMCLDLHPGTNYNVSLRSLSSEL
PVIISLTTQITAEPPVPEVESFTVQRGRLPHLTLRKAKERGGPISSYQVLVLPLDLQSIF
SCDYEGAASFFSNASDTAGYVAAELLAKDVTDDTMEISIGDRLYYGKYYNAPLKTGNDYH
IVLRITSEWNKVRRFSCAVLAQVKGSSLTLEQMVGVGLGSIALVMALAFLSFLAV
Download sequence
Identical sequences ENSCPOP00000005446 10141.ENSCPOP00000005446 ENSCPOP00000005446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]