SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005485 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005485
Domain Number 1 Region: 832-1120
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-78
Family Protein kinases, catalytic subunit 0.000000000326
Further Details:      
 
Domain Number 2 Region: 559-738
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 446-586
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000492
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 4 Region: 352-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000266
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 135-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000467
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005485
Domain Number - Region: 228-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000581
Family Growth factor receptor domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005485   Gene: ENSCPOG00000006080   Transcript: ENSCPOT00000006144
Sequence length 1139
Comment pep:known scaffold:cavPor3:scaffold_133:2737074:2755756:1 gene:ENSCPOG00000006080 transcript:ENSCPOT00000006144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLGLPFLLPIFLLASDVGAAADLTLLANLRLTDPQRFFLTCVSGEAGVGRGSDAWSPP
LLLEKDNSIVRTLSSGQPLRLAHNGSHQVTLRGFSKPSDLVGVFSCVGGTGLRRSRVVYV
HNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKNNGSYFHNQDWQEAKNGRFL
LLVPDAQPSSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKECPGCLHGGVCHD
YDGECVCPPGFTGSRCEQACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRG
SQCQEACAPGHFGADCHLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNVASE
LEFNLETMPRIHCAAAGNPFPVRGSMELRKPDGTVLQSTKAIVEPDKTTAEFEVPRLALG
DSGFWECRVSTSGGQDSQRFKVNVKVPPVPLAAPRLLAKQSRQLVVSPLVSFSGDGPISS
VRLHYRPQDSTVGWSAIVVDPSENVTLMNLKPKTGYSVRVQLSRPGEGGEGAWGPPTLMT
TDCPEPLLQPWLEGWHVEGPDRLRVSWSLPLGPGPLVGDGFLLRLWNGARGQERRENVSS
PQARSTVLTGLTPGTHYHLDVRLYHCTLLGPASPPAHVLLPASGPPAPRHLQAHALSDSE
IQLTWQRPEAPSGPISKYIVEVQVAGGSGDPLWMDVDRPEETNTIVSGLNASTRYLFRVR
ASVQGLGDWSNTVEEATLGNGLQSEGPVQESRAAEEGLDQQLVLAVVGSISATCLTILAA
LLALVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLNYPVLEWEDI
TFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPN
IINLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRF
ASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRW
MAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCD
DEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences H0V6Z2
ENSCPOP00000005485 ENSCPOP00000005485 XP_003462567.1.53824 10141.ENSCPOP00000005485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]