SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005525 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005525
Domain Number 1 Region: 317-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 210-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000643
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 31-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 423-549
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 5 Region: 110-220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000091
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005525   Gene: ENSCPOG00000006125   Transcript: ENSCPOT00000006189
Sequence length 658
Comment pep:known scaffold:cavPor3:scaffold_91:519491:536344:-1 gene:ENSCPOG00000006125 transcript:ENSCPOT00000006189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PILVSEPEMGNREALSLGTEAELPNNLPGDDQDECLLLPGELCQHLCINTVGSYRCACFP
GFLLQDDGHTCRPARIASQPEAPRESATGPEPAQAAPNTIPLPLPQPNTCKDNEPCRQVC
SVIRGSAVCSCFPGYAIMADGVSCEDQDECLLGTHDCSRRQFCVNTLGSFSCVNHTVLCA
EGYILNAHRKCVDINECVTDLHTCSRGEHCVNTLGSFRCYKALTCDPGYVLKDGECVDVD
ECAVGSHTCQPGSSCQNTKGSFYCQARQRCMEGFLQDPEGNCVDINECTSLPEPCRSGFS
CVNTVGSYRCQRDPLMCRHGYHANEDGTQCVDVNECATGVHRCGSGQVCHNLPGSYRCDC
KAGFQRDAFGRSCIDVNECWTSPSRLCQHTCENTLGSYRCSCAMGFRLAEDGKHCEDVNE
CETQRCSQECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQAAGMLCTFRCLNVPGSYQ
CACPEQGYAMMANGRSCKDLDECALGTHNCSEAETCHNLQGSFRCLRFECPPNYVRVSEM
KCERTTCHDLLECQNSPARITYYQLNFQTGLLVPAHIFRIGPAPAFTGDTISLTITRGNE
EGYFGTRRLNAFTGVVSLQRPVLEPRDFALDVEMKLWRQGSVTTFLAKMHIFFTAFAP
Download sequence
Identical sequences ENSCPOP00000005525 ENSCPOP00000005525 10141.ENSCPOP00000005525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]