SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005606 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005606
Domain Number 1 Region: 331-470
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-41
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 2 Region: 914-1062
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-40
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 3 Region: 625-759
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-38
Family C-type lectin domain 0.000000347
Further Details:      
 
Domain Number 4 Region: 769-907
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-37
Family C-type lectin domain 0.00029
Further Details:      
 
Domain Number 5 Region: 1202-1342
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-34
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 6 Region: 2-133
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.03e-33
Family Cysteine rich domain 0.00000122
Further Details:      
 
Domain Number 7 Region: 480-618
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-33
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 8 Region: 1072-1198
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-30
Family C-type lectin domain 0.00094
Further Details:      
 
Domain Number 9 Region: 208-323
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-30
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 10 Region: 133-191
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-20
Family Fibronectin type II module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005606   Gene: ENSCPOG00000006215   Transcript: ENSCPOT00000006280
Sequence length 1439
Comment pep:known scaffold:cavPor3:scaffold_120:1000288:1096790:-1 gene:ENSCPOG00000006215 transcript:ENSCPOT00000006280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTRQFLIYNEDHKRCVEAVNSNAVQTAPCNQDSKLQKFRWVSPDQVMSIAFKLCLGVPSK
TDWVPVTLYPCNSKSEIQKWECKNDTLFGIKGEDLYFNYGNKQEKNVMLYKGSGLWSRWK
IYGTTDDLCSRGYEAVYTLQGNANGAPCAFPFKFGNKLYADCTNAGRSDGWLWCATTADY
DTNKLFGFCPTKFEGSETLWTKDPLTSILYQINSKSALTWQQARKSCQQQDAELLSITEI
HEQTYLTGLTSTLTSGLWIGLNSLSFNSGWQWSGGSPFRYLNWLPGSPSVEPGKSCVSLN
PGKNAKWENLECAQKLGYICKKGNNSLNSFIIPSETGVPSKCPSQWWPYAGHCYKIHKEA
KKIQRDALTACRKEGGDLASIHTIEEFDFIISQLGYEPSDELWIGLNDIKVQMFFEWSDG
TPVTFTKWLRGEPSHENNRQEDCVVMKGKDGFWADRTCEHPLGYICKMKAQAQAPETVEE
ETGCQKGWKRYGYYCYLIGNTLSTFTEANQTCKNEKAYLTTIEDRYEQAFLTSLVGLRPE
KYFWTGLSDIQIKGTFQWTEQEEVQFTHWNADMPGRKAGCVAMRTGIAGGLWDVLKCDQK
AKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTTSKTSSCFKLFAKGKHEKKTWFESRDFC
RALGGDLATIKSKEEQQIIWRLITSTGNYHEVFWLGLTYGGSSEGFTWSSGSPLSYENWA
YGEPNNYNNVEYCGEMKGDPNMYWNDINCEHLNNWICQIQKGKTPNPEPTPAPQENPPVT
EDGWVIYKEYQYYFSKQKESMDNARAFCKRNFGDLVTIKSESEKKFLWKYVNRKDAPSMS
AYFIGLLISVDKTFIWMDGSKVDYVSWAPGEPNFANEDENCVTLYTDSGLWNDINCGYPS
PFICQRHNSSINATTVPTTPPTPGGCKNGWKFYNNKCYKIFGFVEEERKNWQEARKACIG
FKGNLVSILNEREQAFLNSQMKDSTFNAWIGLNDVNSEHKFLWTDGRGVQYTNWGKGFPG
GRRSSLSYEDADCVVITGGKSRDAGKWMDDICDNRKGYICQTLSDSSLPNSPTTVPANGF
IKYGESSYSLMKNKLSWHEAEKYCREYTSLIASILDPYTNSFLWLKMQPFNVPVWIGLNS
NLTNNDYTWIDKWRMRYNNWAANEPKLKSACVYMDVDGFWKTSYCNESFYFLCKRSDEIP
ATEPPQLPGRCPESELNAWIPFHGHCYYIESSFTRNWGQASLECLRMSSSLVSIESAAES
SFLSYLVEPLRSKTNFWIGLFRNVEGPGKWFWLNNSPLSFVNWNSGDPSTERNDCVVMTA
SSGLWSNIHCSSYKGFICKRPKIIDPEPTQTLITTKADSRKMEPTKKSSSAAGVVVVVVL
LIIMGAALAAYYFYKKRRVHIPQETTFENTLYFNSHSSPGTSDTKVLMGNIEQNEHAVI
Download sequence
Identical sequences 10141.ENSCPOP00000005606 ENSCPOP00000005606 ENSCPOP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]