SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005648 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005648
Domain Number 1 Region: 1004-1184
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-17
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 2 Region: 905-986
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000295
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 696-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000361
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 387-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000144
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 5 Region: 753-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 6 Region: 299-424
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 829-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000911
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 543-662
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 9 Region: 659-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000375
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 791-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 431-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1309-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.024
Further Details:      
 
Domain Number 13 Region: 869-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 471-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005648
Domain Number - Region: 265-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000326
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 507-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005648   Gene: ENSCPOG00000006265   Transcript: ENSCPOT00000006330
Sequence length 1404
Comment pep:known scaffold:cavPor3:scaffold_13:23186143:23233341:-1 gene:ENSCPOG00000006265 transcript:ENSCPOT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGAALALLLAAVLGLGARRARGAVALSDFYPFGTARGDAVTPKQDDGGSGLRPLSVPF
PFFGTEHSGLYVNNNGIVSFLKEVSQFTPVAFPIAQDRCVVAAFWADVDNRRAGDVYYRE
ATDAATLHRATADIRQYFPELANFSATWVFIATWYRVTFFGGSSSSPVNTFQIILITDGK
VSFTIFNYESITWTTGTHASSGGDATGLGGIAAQAGFNAGDGRRYFNIPGSRTADMAEVE
ATTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSYTCSCL
AGFTGRRCQLDVNECASHPCQNGGTCTHSVNSFSCQCPAGFRGPTCESAQSLCDNTECQN
GGQCQDERGSAVCVCQAGYTGASCETNVDECSSDPCLNGGACVDLVGNYSCVCVEPFTGP
RCETGSHPVPDACFSAPCQNGGTCVDAGPGHVCECPEGFMGLDCRERTHNDCECRNGGRC
LGSNTTLCQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHS
LPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEAGG
EYHCSCPYRFTGKHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIVPSP
CFRSPCLNGGTCEDLGTDFSCHCQVGYTGRWCQAEVDCGQPEEVEHASMRFNGTHVGSVA
LYMCDHGYSLNAPHHFRVCQPQGVWSQPPQCLEVDKCQSQPCLNGGSCQSHTTGYQCLCS
AGYEGAHCELETDGCRAQPCKNRGSCMDLPGAFICQCPMGFVGVHCETELDACDSSPCLH
GGRCENGGGAYLCVCPEGFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGK
DCGTELLPPTALRVDRVEESGVSISWSPPNSPTARQVLDGYAVTYASSDGSYRRTDFVDR
SHASHQLRALAPGRAYNISVFSVKRNTNNKNDISRPAALLTRTRPRPVEDFEVTNMTAST
VSVRWALHRIHHAAASRVRVSILHPGAPEAQATDVDRSVDQLTFGALLPGRKYTIWVATL
SGPGGAEQPTESRASALLHVWTRPLPPANLTASRVTATSAHMVWDAPTPGVSLEAYVINV
TTNQSTKSRYVPNGKLVSYTVRDLLPGRRYQLSVTAVQGTEQGQLHSEPAHLYIITSPRD
STDRRWHQGGHHTRVLRNRPPPVRLPELRLLNDRSFPEAPTQQPRFLELVDGRRRVSARF
SGPPNKLITSRPQPTSLVSPENTEEAPEQVHLALQLPELSDKDIERARGSCLEDTCHNGG
TCVPGTDTYSCNCGPGFKGRRCELACEKVPRPCTRLFSETKSFPVWEGGICHHMYKRVYK
VHQDVCFRELCESTSLKKPQTGTS
Download sequence
Identical sequences ENSCPOP00000005648 ENSCPOP00000005648 10141.ENSCPOP00000005648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]