SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005701 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005701
Domain Number 1 Region: 1636-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.22e-35
Family Laminin G-like module 0.00061
Further Details:      
 
Domain Number 2 Region: 1461-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 1049-1230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-22
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 1226-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-22
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 5 Region: 833-1028
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.02e-16
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 6 Region: 142-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 7 Region: 188-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 8 Region: 83-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005701   Gene: ENSCPOG00000006325   Transcript: ENSCPOT00000006390
Sequence length 1823
Comment pep:known scaffold:cavPor3:scaffold_58:7407383:7537959:1 gene:ENSCPOG00000006325 transcript:ENSCPOT00000006390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHPAWRGVLLPLWLLCSAACCSAASGDGSAFPFDIEGSSAVGRPDPPETSEPRVTVGT
VPPTLQKCAPGFFRAFSGECLPCDCHGNSNECSDGSGFCLNCQRNTTGERCEKCLAGYIG
DSIREAPHACQPCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLL
IGSTCRKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCA
VCNCGGGPCDSVTGECLEGFELSTGTDCPTISCDKCIWDLTDDLRLAALSIEESKSGLLS
VSSGAAAQRHVSEMNSTIHLLKMKLSERENQYILRKIQVSNAENTMKSLLSDLDELAVKE
SQAARKGQLVHKESMDTTDHATHLAEQAHNMRDKIQEINDKMLYYGEEQELDPEEITEKL
VLAQKMLEEIRRRPPFLTQRELVDAEADEAHELLSQAEIWQRLHNDTRSLFPVVLEQLDD
YNAKLSDLQESLDQALDHIRDAEDMNRATAARQRDHEKQHEKIREQMEVVNTSLSTSAVS
LAMPRLILVELDDIIKNASGIYAEIDGAKTELQGKLSNLSNLNPDLVQEAIDHARNLQQE
ADELSRNLHNSDMNGLVQKALDASNVYENIVNYVGEANETAELALNITDRIYDAVSGIDT
QIIYHKDESDHLLNQARELEARADSSSEEAVADTSRRVSGALTRKSALKHRLDDAIKRLQ
AAERGDVRQRLGQSKMIVEQANKTTVEVQKVTAPMANNLTNWSQNLQNFDSSVYNTAVDS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVDVHPKTSMDDLKAFTSLSLYMKPPAKQSELGGTADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFAGDDSLLDLDPKDTVFYVGGVPSNFKLPASLNLPGYVGCLELATLNSDVISLYN
FKHIYNMDPLKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLVLLMVNGSTFFSLEMRSGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRGHLPLDINFRG
CMKGFQFQKKDFNLLEQKETLGVGYGCPEDSLVSRRAYFNGQSFIASTQKISFFDGFEGG
FNFRTLQPNGLLFYYASGADVFSISLDNGTVTLNVKGTKVQSAEKQYNDGLAHFVSTSVS
PTRYELVVDKSRHGNKNPTKGKAEQNQAGEKKFYFGGSPISPQYANFTGCISNAYFTRLD
KDVEVEDFQRYSEKVHTSLYECPIESSPLFLHHKKGKNSSRPKPNQNRKGGKSKDAPSWD
PVGLKFLEHSAPRDAHCHLSNSPRAIEHAYQYGGTANSRQEFEHLTGDFGEKSQFSILLK
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQERYNDGLWHDVIFVR
EKSSGRLIIDGLRVLEESLPPTETAWKIKGPIYLGGVAPGRAVKNVQINSVYSFSGCLRN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMNNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPTKPFTGCIRHFVIDG
RPVSFNKAALVSGAVSINSCPAA
Download sequence
Identical sequences 10141.ENSCPOP00000005701 ENSCPOP00000005701 ENSCPOP00000005701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]