SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005825 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000005825
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00263
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00935
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 608-737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0108
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0213
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 749-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0248
Family Laminin-type module 0.062
Further Details:      
 
Domain Number - Region: 189-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.066
Further Details:      
 
Domain Number - Region: 579-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 230-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0682
Family Laminin-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005825   Gene: ENSCPOG00000006468   Transcript: ENSCPOT00000006533
Sequence length 1091
Comment pep:novel scaffold:cavPor3:scaffold_101:1101812:1279663:1 gene:ENSCPOG00000006468 transcript:ENSCPOT00000006533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPETGLAVFFLLRMAFTLNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSHDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPLGTFGFQCSQLCDCHNGGQCSPTTGACECSPGYKGPRCQERLCPEGLHGPLCSL
PCPCDPDNTVSCHPVTGACTCQPGWSGHHCNESCPAGYYGDGCQLPCSCQNGADCHSVTG
GCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCHNGGTCSPVDGSCACKEGWQGPDCALPC
PSGTWGLNCNETCACANGAACSPADGACTCAPGWLGDTCELPCPDGTFGLNCSERCDCSH
ADGCDPISGHCCCLAGWTGVRCDSTCPAGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGLSCAQPCPLCVHSSGPCHHVSGLCECLPGFSGALCNQVCAGGHFG
QDCAQLCSCANNGSCSPIDGSCQCFPGWIGKDCSQACPPGFWGSACFHTCSCHNGASCNA
EDGACHCAPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGRYCE
QRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSSGFKGIRCDQAALMMEELNPYTKISP
ALGAERQSVGAVTGIILLLFLLVVLLGLFAWRRRRHKEKGRELAPRVSYTPAMRMTSTDY
SLSDLSQSSSHTQCFSNSSYHTLACGGPATSQASTLDRNSPTKLSTKSLDTDTTGWTPYS
YVNVLDSHFQISALEARYPPEDFYIEFRHLSRPAEPHSPGACGMDRRQNTYIMDKDFKDY
MKESVCSSSTCSLNSSENPYATIKDPPILPCKLPENSYVEMKSPVHRGSPYTDVPSLSTS
NKNIYEVGRCL
Download sequence
Identical sequences ENSCPOP00000005825 10141.ENSCPOP00000005825 ENSCPOP00000005825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]