SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005919 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000005919
Domain Number - Region: 403-463
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000811
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005919   Gene: ENSCPOG00000006572   Transcript: ENSCPOT00000006638
Sequence length 761
Comment pep:known scaffold:cavPor3:scaffold_2:73041862:73162199:1 gene:ENSCPOG00000006572 transcript:ENSCPOT00000006638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWRFVELLYFLFVWGRISVQPSRQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVER
HRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDT
IIKKYGTHLLISATLGGEEALTMYMDKSHLDRKSGNATQSVEALHQLASSYFVDRDGTMR
RLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQE
KFVQSALSYIMCNGEGEYVCQNSQCRCRCAEEFPQCNCPVTDIQVMEYTLANMAKSWAEA
YKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATEAQRQKIQRTA
RKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT
LCQRPIPCIIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETD
LDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHM
VIGMSMRICQMRNSSLDPMFFVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNW
TLLLGNRWKTFFETVHIYLRSRTRLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGY
SLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLF
SCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
Download sequence
Identical sequences H0V836
10141.ENSCPOP00000005919 XP_003478888.1.53824 ENSCPOP00000005919 ENSCPOP00000005919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]