SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006040 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006040
Domain Number 1 Region: 194-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000393
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006040   Gene: ENSCPOG00000006705   Transcript: ENSCPOT00000006773
Sequence length 420
Comment pep:known scaffold:cavPor3:scaffold_87:804793:810922:-1 gene:ENSCPOG00000006705 transcript:ENSCPOT00000006773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPQTPRVLVSVLLWDLNLFLSLPGPAWLQPSPPPQSPPPSEPHPCHTCRALVDSFNKGL
ERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEAVCAKSDFQCHRLLELSEELVESWW
FHKQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCQGEGTRGGSGQ
CDCQAGYGGEACGQCGLGYFEAERNSSHLVCLACFGPCARCSGPEESHCLQCKKGWALHH
LKCVDIDECGTERASCGADQFCVNTEGAYECRDCAKACLGCMGAGPGRCKKCSPGYQQVG
SKCLDVDECETVVCPGENEKCQNTEGSYRCVCAEGYKQVEGICVKEQIPESAGFFSEMTE
DELVVLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Download sequence
Identical sequences H0V8E3
XP_003464131.3.53824 XP_013001763.1.53824 10141.ENSCPOP00000006040 ENSCPOP00000006040 ENSCPOP00000006040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]