SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006305 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006305
Domain Number 1 Region: 29-293
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-92
Family Sulfatase-modifying factor-like 0.000000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006305   Gene: ENSCPOG00000006993   Transcript: ENSCPOT00000007062
Sequence length 301
Comment pep:known scaffold:cavPor3:scaffold_66:3224205:3234831:1 gene:ENSCPOG00000006993 transcript:ENSCPOT00000007062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCQGYPLSPVVQLLLFVFLYSGNSQAADMVQLLGGQFLMGTDASDARDGEGPAREVTVK
PFAIDIFPVTNKDFREFVREKKYRTEAELFGWSFVFEDLVSSELRNSASQQMKPVLWWLP
VERAFWRQPSGPGSGIRDRLELPVLHVSWNDAQAYCAWRGRRLPTEEEWEFAARGGLKGQ
VYPWGNRFQPNRTNLWQGKFPKGDRAEDGFHGVSPVNAFPPQNDYGLYDLMGNVWEWTAS
SYQPAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAASVGRAFGE
L
Download sequence
Identical sequences ENSCPOP00000006305 10141.ENSCPOP00000006305 ENSCPOP00000006305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]